BLASTX nr result
ID: Glycyrrhiza28_contig00015587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015587 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074099529.1 hypothetical protein [Escherichia coli] OKP55887.... 64 1e-11 XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [D... 59 1e-09 EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela... 55 5e-08 XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes v... 51 1e-06 >WP_074099529.1 hypothetical protein [Escherichia coli] OKP55887.1 hypothetical protein A8A03_03210 [Escherichia coli] Length = 67 Score = 63.9 bits (154), Expect = 1e-11 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +1 Query: 124 LQANISFGSRIKVS*MWHPRVCYSF*LNTISGTEERSAPQGKGSDLFALRML 279 LQA+I F I V MWHPR+CYS L+T+ GTE+RS P G S+ FALRML Sbjct: 15 LQASIGFVCWIIVGEMWHPRMCYSLLLDTVDGTEDRSVPYGGSSETFALRML 66 >XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] EJF55541.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] Length = 59 Score = 58.9 bits (141), Expect = 1e-09 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = -2 Query: 247 CLAARCVPQSQKSYSVRSYNTPVGATFN*PLSDYRN*CWPAKIRNTH 107 CLAARCVP+SQ Y+ R YNTP GAT P SD +N CWP R H Sbjct: 2 CLAARCVPRSQPPYATRVYNTPEGATLLQPFSDGQNRCWPVN-RKVH 47 >EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia subvermispora B] Length = 87 Score = 55.5 bits (132), Expect = 5e-08 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = -2 Query: 262 KGRNLCLAARCVPQSQKSYSVRSYNTPVGATFN*PLSDYRN*CWP 128 +GR + A C P+SQ SY+ YNTP GATF P SD RN CWP Sbjct: 25 RGRTPTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWP 69 >XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] EIW51413.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] Length = 51 Score = 50.8 bits (120), Expect = 1e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -2 Query: 238 ARCVPQSQKSYSVRSYNTPVGATFN*PLSDYRN*CWPAKIRNTH 107 ARCVP+SQ Y+ YNTP GATF P S +N CWP R H Sbjct: 9 ARCVPRSQPLYATEGYNTPEGATFLQPFSSGQNRCWPVN-RKVH 51