BLASTX nr result
ID: Glycyrrhiza28_contig00015541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015541 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] 69 1e-12 EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus a... 58 1e-08 >CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] Length = 189 Score = 68.9 bits (167), Expect = 1e-12 Identities = 38/72 (52%), Positives = 43/72 (59%) Frame = +1 Query: 13 LPISRPTFLDRDNHRPAQLPSCVTPVNTLTAPDGFER*TGSFTPKGSISRVRTLSTTGLA 192 L PT LD DNHR A LPSCVTPVNT T+ D + T T K +R +S T Sbjct: 98 LTTDNPTRLDHDNHRVAWLPSCVTPVNTFTSKDRVPQPT-QHTNKSLHIMLRMVSITISV 156 Query: 193 WAVFRQYGNINP 228 WAVF +YGNINP Sbjct: 157 WAVFHRYGNINP 168 >EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] Length = 191 Score = 58.2 bits (139), Expect = 1e-08 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = +1 Query: 52 HRPAQLPSCVTPVNTLTAPDGFER*TGSFTPKGSISRVRTLSTTGLAWAVFRQYGNINP 228 H PA+LPSCVTPVN L +P R K VR +S TG W V YGNINP Sbjct: 112 HCPARLPSCVTPVNALASPVQVPRSPSPTPSKTRFGMVRAVSITGSTWTVLHWYGNINP 170