BLASTX nr result
ID: Glycyrrhiza28_contig00015481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015481 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCG06601.1 Putative uncharacterized protein, partial [Pararhodos... 126 3e-36 EDM70194.1 hypothetical protein RAZWK3B_11316 [Roseobacter sp. A... 124 2e-35 JAN66192.1 hypothetical protein [Daphnia magna] 118 6e-33 EEP52471.1 conserved hypothetical protein [Clostridium butyricum... 116 3e-32 EEP52328.1 conserved hypothetical protein [Clostridium butyricum... 116 4e-32 EES47786.1 conserved hypothetical protein [Clostridium botulinum... 113 7e-31 EES47791.1 conserved hypothetical protein [Clostridium botulinum... 113 1e-30 AAO34720.1 hypothetical protein CTC_00065 [Clostridium tetani E8... 115 1e-30 KPY16424.1 Uncharacterized protein ALO55_04102 [Pseudomonas sava... 111 3e-30 CAJ30047.1 conserved hypothetical protein [Magnetospirillum gryp... 111 8e-30 ETJ01449.1 Cell wall-associated hydrolase [Actinomyces urogenita... 109 9e-30 EDS76139.1 conserved hypothetical protein [Clostridium botulinum... 108 3e-29 EDS79280.1 conserved hypothetical protein [Clostridium perfringe... 112 3e-29 EDS79006.1 conserved hypothetical protein [Clostridium perfringe... 112 3e-29 EFG86088.1 hypothetical protein CLCAR_4307 [Clostridium carboxid... 112 5e-29 EDT79991.1 conserved hypothetical protein [Clostridium botulinum... 109 2e-28 ELY20074.1 hypothetical protein HALTITAN_3299 [Halomonas titanic... 108 3e-28 EDT79985.1 conserved hypothetical protein [Clostridium botulinum... 109 4e-28 ACO83728.1 conserved hypothetical protein [Clostridium botulinum... 109 4e-28 EDS76152.1 conserved hypothetical protein [Clostridium botulinum... 108 4e-28 >CCG06601.1 Putative uncharacterized protein, partial [Pararhodospirillum photometricum DSM 122] Length = 104 Score = 126 bits (316), Expect = 3e-36 Identities = 60/76 (78%), Positives = 64/76 (84%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN AVD+DSWA SACYP+ TFYPLSDGPSTRDHRITMT FRLCS SRSQAG CH Sbjct: 2 DIEVPNTAVDVDSWAVSACYPQSTFYPLSDGPSTRDHRITMTVFRLCSNRRSRSQAGFCH 61 Query: 182 YTQRTISDRSEPTFAR 229 T++ ISDR EPT AR Sbjct: 62 CTRQPISDRPEPTIAR 77 >EDM70194.1 hypothetical protein RAZWK3B_11316 [Roseobacter sp. AzwK-3b] EDM72671.1 hypothetical protein RAZWK3B_00585 [Roseobacter sp. AzwK-3b] Length = 93 Score = 124 bits (310), Expect = 2e-35 Identities = 58/66 (87%), Positives = 58/66 (87%) Frame = +2 Query: 32 MDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCHYTQRTISDRS 211 MDSWA SACYPRRTFYPLSDGPSTRDHRITM FRLCSTC S SQAG CH TQR ISDRS Sbjct: 1 MDSWAVSACYPRRTFYPLSDGPSTRDHRITMAVFRLCSTCQSCSQAGFCHCTQRAISDRS 60 Query: 212 EPTFAR 229 EPTFAR Sbjct: 61 EPTFAR 66 >JAN66192.1 hypothetical protein [Daphnia magna] Length = 105 Score = 118 bits (295), Expect = 6e-33 Identities = 57/74 (77%), Positives = 60/74 (81%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN AVDM+SWA SACYPR TFYPLSDGPS ++HRIT T FR CSTC SRSQA C Sbjct: 3 DIEVPNTAVDMNSWAVSACYPRSTFYPLSDGPSIQNHRITKTYFRTCSTCLSRSQARFCL 62 Query: 182 YTQRTISDRSEPTF 223 YT R ISDRSE TF Sbjct: 63 YTLRPISDRSERTF 76 >EEP52471.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 115 Score = 116 bits (291), Expect = 3e-32 Identities = 57/76 (75%), Positives = 60/76 (78%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD++SW SACYPR +FYPLSDGP TR HRIT DFR CSTC SRSQA LC Sbjct: 5 DIEVPNLPVDVNSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCL 64 Query: 182 YTQRTISDRSEPTFAR 229 YT RTISDRSE TF R Sbjct: 65 YTLRTISDRSEGTFGR 80 >EEP52328.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP52409.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP52467.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP52590.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP52596.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP54629.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP55337.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP55528.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] EEP55861.1 conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 127 Score = 116 bits (291), Expect = 4e-32 Identities = 57/76 (75%), Positives = 60/76 (78%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD++SW SACYPR +FYPLSDGP TR HRIT DFR CSTC SRSQA LC Sbjct: 5 DIEVPNLPVDVNSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCL 64 Query: 182 YTQRTISDRSEPTFAR 229 YT RTISDRSE TF R Sbjct: 65 YTLRTISDRSEGTFGR 80 >EES47786.1 conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 116 Score = 113 bits (282), Expect = 7e-31 Identities = 56/76 (73%), Positives = 59/76 (77%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD++SW SACYPR +FYPLSDGP TR HRIT DFR CSTC SRSQA LC Sbjct: 5 DIEVPNLPVDVNSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T RTISDRSE TF R Sbjct: 65 CTLRTISDRSEGTFGR 80 >EES47791.1 conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT E Beluga'] EES48583.1 conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT E Beluga'] EES49937.1 conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 127 Score = 113 bits (282), Expect = 1e-30 Identities = 56/76 (73%), Positives = 59/76 (77%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD++SW SACYPR +FYPLSDGP TR HRIT DFR CSTC SRSQA LC Sbjct: 5 DIEVPNLPVDVNSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T RTISDRSE TF R Sbjct: 65 CTLRTISDRSEGTFGR 80 >AAO34720.1 hypothetical protein CTC_00065 [Clostridium tetani E88] AAO34742.1 hypothetical protein CTC_00089 [Clostridium tetani E88] AAO34862.1 hypothetical protein CTC_00214 [Clostridium tetani E88] AAO35169.1 hypothetical protein CTC_00549 [Clostridium tetani E88] CAO85713.1 hypothetical CTC00065-like protein [Clostridium sp.] Length = 218 Score = 115 bits (289), Expect = 1e-30 Identities = 55/76 (72%), Positives = 59/76 (77%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR+HRIT DFR CSTC RSQA LC Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRNHRITKPDFRPCSTCMCRSQAPLCL 64 Query: 182 YTQRTISDRSEPTFAR 229 YT R ISDR+E TF R Sbjct: 65 YTLRAISDRAEGTFGR 80 >KPY16424.1 Uncharacterized protein ALO55_04102 [Pseudomonas savastanoi pv. phaseolicola] Length = 100 Score = 111 bits (277), Expect = 3e-30 Identities = 53/71 (74%), Positives = 57/71 (80%) Frame = +2 Query: 11 VPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCHYTQ 190 +PN AVDM+SWA SACYPR TFYPLSDGPS ++HRIT T FR CSTC SRSQA C YT Sbjct: 1 MPNTAVDMNSWAVSACYPRSTFYPLSDGPSIQNHRITKTYFRTCSTCLSRSQARFCLYTL 60 Query: 191 RTISDRSEPTF 223 R ISDRSE TF Sbjct: 61 RPISDRSERTF 71 >CAJ30047.1 conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] Length = 149 Score = 111 bits (278), Expect = 8e-30 Identities = 52/73 (71%), Positives = 57/73 (78%) Frame = +2 Query: 11 VPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCHYTQ 190 +PN VD+DSW SACYPRRTFY LSDGPS RDHRITMTDFRLCS C SQA LCH T+ Sbjct: 1 MPNLPVDVDSWGRSACYPRRTFYSLSDGPSMRDHRITMTDFRLCSACGPHSQASLCHCTR 60 Query: 191 RTISDRSEPTFAR 229 + ISD+ E T AR Sbjct: 61 QLISDQLELTIAR 73 >ETJ01449.1 Cell wall-associated hydrolase [Actinomyces urogenitalis DORA_12] Length = 91 Score = 109 bits (273), Expect = 9e-30 Identities = 53/76 (69%), Positives = 58/76 (76%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN AVDMDSWA SACYPR TFYPLSD P TRD RIT + FR C T SRSQA LC Sbjct: 5 DIEVPNHAVDMDSWAGSACYPRGTFYPLSDDPPTRDRRITSSYFRTCLTRRSRSQAPLCT 64 Query: 182 YTQRTISDRSEPTFAR 229 YTQ ++D++E TF R Sbjct: 65 YTQHLVADQAEGTFER 80 >EDS76139.1 conserved hypothetical protein [Clostridium botulinum C str. Eklund] EES90462.1 conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 107 Score = 108 bits (271), Expect = 3e-29 Identities = 52/76 (68%), Positives = 57/76 (75%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGPS ++HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T R ISDR+E TF R Sbjct: 65 CTLRAISDRAEGTFGR 80 >EDS79280.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] Length = 218 Score = 112 bits (279), Expect = 3e-29 Identities = 55/76 (72%), Positives = 57/76 (75%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCGCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T RTISDRSE TF R Sbjct: 65 CTLRTISDRSEGTFGR 80 >EDS79006.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS79812.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS80018.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS80484.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS80537.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS80828.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS81221.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS81357.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDS81626.1 conserved hypothetical protein [Clostridium perfringens C str. JGS1495] EDT13241.1 conserved hypothetical protein [Clostridium perfringens E str. JGS1987] EDT13380.1 conserved hypothetical protein [Clostridium perfringens E str. JGS1987] EDT14999.1 conserved hypothetical protein [Clostridium perfringens E str. JGS1987] EDT22129.1 conserved hypothetical protein [Clostridium perfringens B str. ATCC 3626] EDT25416.1 conserved hypothetical protein [Clostridium perfringens CPE str. F4969] EDT77150.1 conserved hypothetical protein [Clostridium perfringens NCTC 8239] EDT77157.1 conserved hypothetical protein [Clostridium perfringens NCTC 8239] Length = 218 Score = 112 bits (279), Expect = 3e-29 Identities = 55/76 (72%), Positives = 57/76 (75%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCGCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T RTISDRSE TF R Sbjct: 65 CTLRTISDRSEGTFGR 80 >EFG86088.1 hypothetical protein CLCAR_4307 [Clostridium carboxidivorans P7] Length = 230 Score = 112 bits (279), Expect = 5e-29 Identities = 54/76 (71%), Positives = 58/76 (76%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR+HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRNHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T RTIS+RSE TF R Sbjct: 65 CTLRTISNRSEGTFGR 80 >EDT79991.1 conserved hypothetical protein [Clostridium botulinum NCTC 2916] Length = 184 Score = 109 bits (272), Expect = 2e-28 Identities = 53/76 (69%), Positives = 56/76 (73%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T R ISDR+E TF R Sbjct: 65 CTLRAISDRAEGTFGR 80 >ELY20074.1 hypothetical protein HALTITAN_3299 [Halomonas titanicae BH1] Length = 163 Score = 108 bits (269), Expect = 3e-28 Identities = 51/71 (71%), Positives = 58/71 (81%) Frame = +2 Query: 11 VPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCHYTQ 190 +PN AVD++SWA SACYPR TFYPLSDGPS ++HRIT T FR CSTC SRSQA LC TQ Sbjct: 1 MPNTAVDVNSWAVSACYPRSTFYPLSDGPSIQNHRITRTCFRTCSTCLSRSQAPLCSCTQ 60 Query: 191 RTISDRSEPTF 223 T+SDR+E TF Sbjct: 61 CTMSDRAEGTF 71 >EDT79985.1 conserved hypothetical protein [Clostridium botulinum NCTC 2916] ACO83981.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] ACO85553.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] ACO86758.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 109 bits (272), Expect = 4e-28 Identities = 53/76 (69%), Positives = 56/76 (73%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T R ISDR+E TF R Sbjct: 65 CTLRAISDRAEGTFGR 80 >ACO83728.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] ACO85637.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] ACO87060.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] ACO87212.1 conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 109 bits (272), Expect = 4e-28 Identities = 53/76 (69%), Positives = 56/76 (73%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGP TR HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPPTRYHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T R ISDR+E TF R Sbjct: 65 CTLRAISDRAEGTFGR 80 >EDS76152.1 conserved hypothetical protein [Clostridium botulinum C str. Eklund] Length = 210 Score = 108 bits (271), Expect = 4e-28 Identities = 52/76 (68%), Positives = 57/76 (75%) Frame = +2 Query: 2 DIEVPNDAVDMDSWASSACYPRRTFYPLSDGPSTRDHRITMTDFRLCSTCWSRSQAGLCH 181 DIEVPN VD+DSW SACYPR +FYPLSDGPS ++HRIT DFR CSTC RSQA C Sbjct: 5 DIEVPNLPVDVDSWGRSACYPRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCL 64 Query: 182 YTQRTISDRSEPTFAR 229 T R ISDR+E TF R Sbjct: 65 CTLRAISDRAEGTFGR 80