BLASTX nr result
ID: Glycyrrhiza28_contig00015394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015394 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAN69566.1 hypothetical protein Abol_046_003 [Acetobacter orlean... 68 1e-13 EEY11248.1 hypothetical protein COI_0097 [Mannheimia haemolytica... 48 6e-06 >GAN69566.1 hypothetical protein Abol_046_003 [Acetobacter orleanensis JCM 7639] GAN61743.1 hypothetical protein Abin_001_001 [Acetobacter indonesiensis 5H-1] Length = 77 Score = 68.2 bits (165), Expect = 1e-13 Identities = 37/51 (72%), Positives = 39/51 (76%) Frame = +1 Query: 1 GERPIKLGNSWFSAKTI*VVRRANTSGGRALDGLWGLTVLLILTKLRIPES 153 GERPIKLGNSWFSAK+I V R+ T GGRALDGL G L LTKLRIP S Sbjct: 4 GERPIKLGNSWFSAKSIEVDRQEFTPGGRALDGLGGPKALPNLTKLRIPGS 54 >EEY11248.1 hypothetical protein COI_0097 [Mannheimia haemolytica serotype A2 str. OVINE] EEY13892.1 hypothetical protein COK_0004 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 47 Score = 47.8 bits (112), Expect = 6e-06 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = -3 Query: 187 DVSTRRVSAE*YSQVFGVWLGSVRR*VPIAHPVLYPLRYSLDALPK 50 DVST RVS E +S VF V +G V R P+A VLYP R L ALPK Sbjct: 2 DVSTHRVSPEYHSSVFAVCIGLVIRDGPLAETVLYPRRCPLKALPK 47