BLASTX nr result
ID: Glycyrrhiza28_contig00014903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00014903 (524 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN11578.1 Inositol hexakisphosphate and diphosphoinositol-penta... 84 8e-16 XP_006587770.1 PREDICTED: inositol hexakisphosphate and diphosph... 84 8e-16 XP_012568021.1 PREDICTED: inositol hexakisphosphate and diphosph... 84 8e-16 XP_006587769.1 PREDICTED: inositol hexakisphosphate and diphosph... 84 8e-16 XP_004489162.1 PREDICTED: inositol hexakisphosphate and diphosph... 84 8e-16 XP_006587768.1 PREDICTED: inositol hexakisphosphate and diphosph... 84 8e-16 KYP69274.1 Inositol hexakisphosphate and diphosphoinositol-penta... 84 8e-16 KRH01117.1 hypothetical protein GLYMA_18G255000 [Glycine max] 83 3e-15 KHN13660.1 Inositol hexakisphosphate and diphosphoinositol-penta... 83 3e-15 XP_003552506.1 PREDICTED: inositol hexakisphosphate and diphosph... 83 3e-15 XP_006602897.1 PREDICTED: inositol hexakisphosphate and diphosph... 83 3e-15 XP_014497826.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 4e-15 XP_017418437.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 4e-15 XP_014497825.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 4e-15 XP_017418436.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 4e-15 XP_014497824.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 4e-15 GAU16467.1 hypothetical protein TSUD_166990 [Trifolium subterran... 82 4e-15 XP_015962823.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 7e-15 XP_015962822.1 PREDICTED: inositol hexakisphosphate and diphosph... 82 7e-15 XP_007139607.1 hypothetical protein PHAVU_008G044100g [Phaseolus... 81 1e-14 >KHN11578.1 Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase [Glycine soja] Length = 874 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 838 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 874 >XP_006587770.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X3 [Glycine max] Length = 948 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 912 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 948 >XP_012568021.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Cicer arietinum] Length = 1053 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 1053 >XP_006587769.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Glycine max] KRH40139.1 hypothetical protein GLYMA_09G241100 [Glycine max] KRH40140.1 hypothetical protein GLYMA_09G241100 [Glycine max] Length = 1053 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 1053 >XP_004489162.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Cicer arietinum] Length = 1059 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 1023 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 1059 >XP_006587768.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Glycine max] KRH40141.1 hypothetical protein GLYMA_09G241100 [Glycine max] KRH40142.1 hypothetical protein GLYMA_09G241100 [Glycine max] Length = 1059 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 1023 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 1059 >KYP69274.1 Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase [Cajanus cajan] Length = 1066 Score = 84.3 bits (207), Expect = 8e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK Sbjct: 1030 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 1066 >KRH01117.1 hypothetical protein GLYMA_18G255000 [Glycine max] Length = 777 Score = 82.8 bits (203), Expect = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKH NSNGK Sbjct: 741 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHGNSNGK 777 >KHN13660.1 Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase [Glycine soja] Length = 1053 Score = 82.8 bits (203), Expect = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKH NSNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHGNSNGK 1053 >XP_003552506.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Glycine max] KRH01115.1 hypothetical protein GLYMA_18G255000 [Glycine max] Length = 1053 Score = 82.8 bits (203), Expect = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKH NSNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHGNSNGK 1053 >XP_006602897.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Glycine max] Length = 1059 Score = 82.8 bits (203), Expect = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKH NSNGK Sbjct: 1023 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHGNSNGK 1059 >XP_014497826.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase-like isoform X3 [Vigna radiata var. radiata] Length = 948 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 912 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 948 >XP_017418437.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Vigna angularis] BAT83409.1 hypothetical protein VIGAN_04055100 [Vigna angularis var. angularis] Length = 1053 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 1053 >XP_014497825.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Vigna radiata var. radiata] Length = 1053 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 1017 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 1053 >XP_017418436.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Vigna angularis] Length = 1059 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 1023 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 1059 >XP_014497824.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Vigna radiata var. radiata] Length = 1059 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 1023 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 1059 >GAU16467.1 hypothetical protein TSUD_166990 [Trifolium subterraneum] Length = 1060 Score = 82.4 bits (202), Expect = 4e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHA+SNGK Sbjct: 1024 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHAHSNGK 1060 >XP_015962823.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Arachis duranensis] XP_016194196.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X2 [Arachis ipaensis] Length = 1055 Score = 81.6 bits (200), Expect = 7e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPP TPAGFSGYFSKSVLERLVNLWPFHKHAN+NGK Sbjct: 1019 FPPPTTPAGFSGYFSKSVLERLVNLWPFHKHANTNGK 1055 >XP_015962822.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Arachis duranensis] XP_016194195.1 PREDICTED: inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2-like isoform X1 [Arachis ipaensis] Length = 1061 Score = 81.6 bits (200), Expect = 7e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPP TPAGFSGYFSKSVLERLVNLWPFHKHAN+NGK Sbjct: 1025 FPPPTTPAGFSGYFSKSVLERLVNLWPFHKHANTNGK 1061 >XP_007139607.1 hypothetical protein PHAVU_008G044100g [Phaseolus vulgaris] ESW11601.1 hypothetical protein PHAVU_008G044100g [Phaseolus vulgaris] Length = 1053 Score = 80.9 bits (198), Expect = 1e-14 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 522 FPPPATPAGFSGYFSKSVLERLVNLWPFHKHANSNGK 412 FPPPATPAGFSGYFSK VLERLVNLWPFHKHA+SNGK Sbjct: 1017 FPPPATPAGFSGYFSKGVLERLVNLWPFHKHAHSNGK 1053