BLASTX nr result
ID: Glycyrrhiza28_contig00014860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00014860 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAN51005.1 PilT-like protein [Methylobacterium sp. ME121] 110 7e-29 WP_043388473.1 twitching motility protein PilT [Methylobacterium... 109 2e-28 WP_007568961.1 MULTISPECIES: twitching motility protein PilT [Ba... 103 4e-26 WP_050736430.1 twitching motility protein PilT [Methylobacterium... 103 5e-26 SFJ63155.1 PIN domain nuclease, a component of toxin-antitoxin s... 96 5e-23 WP_007564672.1 twitching motility protein PilT [Methylobacterium... 94 2e-22 WP_066615172.1 twitching motility protein PilT [Bosea sp. PAMC 2... 88 6e-20 WP_056396895.1 MULTISPECIES: twitching motility protein PilT [Sp... 82 1e-17 XP_003343578.1 hypothetical protein SMAC_11764 [Sordaria macrosp... 81 1e-17 WP_051583537.1 twitching motility protein PilT [Sphingomonas sp.... 80 3e-17 EZP50462.1 putative toxin of toxin-antitoxin system [Sphingomona... 80 4e-17 SEP05674.1 PIN domain nuclease, a component of toxin-antitoxin s... 80 6e-17 WP_010890946.1 MULTISPECIES: twitching motility protein PilT [No... 79 2e-16 ODU67723.1 twitching motility protein PilT [Novosphingobium sp. ... 79 2e-16 WP_062343922.1 twitching motility protein PilT [Novosphingobium ... 79 2e-16 WP_017502530.1 twitching motility protein PilT [Sphingobium yano... 79 2e-16 WP_056000813.1 twitching motility protein PilT [Sphingomonas sp.... 78 3e-16 WP_006949416.1 MULTISPECIES: PIN domain-containing protein [Sphi... 78 3e-16 WP_053220997.1 hypothetical protein [Methylobacterium platani] 76 3e-16 KMO16207.1 twitching motility protein PilT, partial [Methylobact... 76 4e-16 >GAN51005.1 PilT-like protein [Methylobacterium sp. ME121] Length = 129 Score = 110 bits (275), Expect = 7e-29 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSY+AGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWS IAEAAGVVVEMIR Sbjct: 73 LSYDAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSMIAEAAGVVVEMIR 129 >WP_043388473.1 twitching motility protein PilT [Methylobacterium sp. UNCCL110] SFV12467.1 PIN domain nuclease, a component of toxin-antitoxin system (PIN domain) [Methylobacterium sp. UNCCL125] Length = 129 Score = 109 bits (272), Expect = 2e-28 Identities = 55/57 (96%), Positives = 55/57 (96%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSYEAGMLRPLTV GGLSLGDRYCLALAKREG PALTAERRWSTIAEAAGVVVEMIR Sbjct: 73 LSYEAGMLRPLTVAGGLSLGDRYCLALAKREGRPALTAERRWSTIAEAAGVVVEMIR 129 >WP_007568961.1 MULTISPECIES: twitching motility protein PilT [Bacteria] EIZ81656.1 PilT-like protein [Methylobacterium sp. GXF4] KIU27395.1 twitching motility protein PilT [Methylobacterium radiotolerans] KOX43593.1 twitching motility protein PilT [Streptomyces purpurogeneiscleroticus] Length = 129 Score = 103 bits (257), Expect = 4e-26 Identities = 52/57 (91%), Positives = 54/57 (94%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSYEAGMLRPLTVEGGLSLGDRYCLALAK+E PALTAERRW+TIAEAA VVVEMIR Sbjct: 73 LSYEAGMLRPLTVEGGLSLGDRYCLALAKQEDRPALTAERRWTTIAEAADVVVEMIR 129 >WP_050736430.1 twitching motility protein PilT [Methylobacterium sp. ARG-1] KNY19171.1 twitching motility protein PilT [Methylobacterium sp. ARG-1] Length = 129 Score = 103 bits (256), Expect = 5e-26 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSY+AGMLRPLT+EGGLSLGDRYCLALAKRE LPALTAERRW+ IA AAGV VEMIR Sbjct: 73 LSYDAGMLRPLTIEGGLSLGDRYCLALAKRENLPALTAERRWAAIAAAAGVTVEMIR 129 >SFJ63155.1 PIN domain nuclease, a component of toxin-antitoxin system (PIN domain) [Methylobacterium brachiatum] Length = 129 Score = 95.5 bits (236), Expect = 5e-23 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSY+AG+LR +T+EGGLSLGDRYCLALAKREG+PALTAERRW IA AAGV +E+IR Sbjct: 73 LSYDAGLLRSITLEGGLSLGDRYCLALAKREGVPALTAERRWPDIAGAAGVTIELIR 129 >WP_007564672.1 twitching motility protein PilT [Methylobacterium sp. GXF4] EIZ83766.1 hypothetical protein WYO_3510 [Methylobacterium sp. GXF4] Length = 129 Score = 94.0 bits (232), Expect = 2e-22 Identities = 44/57 (77%), Positives = 51/57 (89%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSY+AG+LR +T+EGGLSLGDRYCLALAKREG+PALTAERRW IA A GV +E+IR Sbjct: 73 LSYDAGLLRSITLEGGLSLGDRYCLALAKREGVPALTAERRWPDIAGAVGVTIELIR 129 >WP_066615172.1 twitching motility protein PilT [Bosea sp. PAMC 26642] AMJ61692.1 twitching motility protein PilT [Bosea sp. PAMC 26642] Length = 129 Score = 87.8 bits (216), Expect = 6e-20 Identities = 44/57 (77%), Positives = 48/57 (84%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LSY+AGMLRPLT+ GGLSLGDR CLALA+R PALT ERRW IAEAAGV VE+IR Sbjct: 73 LSYDAGMLRPLTLAGGLSLGDRCCLALARRMNRPALTGERRWPEIAEAAGVRVELIR 129 >WP_056396895.1 MULTISPECIES: twitching motility protein PilT [Sphingomonas] KQM21429.1 twitching motility protein PilT [Sphingomonas sp. Leaf5] KQM93546.1 twitching motility protein PilT [Sphingomonas sp. Leaf24] Length = 129 Score = 82.0 bits (201), Expect = 1e-17 Identities = 41/58 (70%), Positives = 47/58 (81%) Frame = +2 Query: 2 GLSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 GL +EAG LR LT+E GLSLGDR+CLALAKRE LPA TA+R+W IA+AAGV V IR Sbjct: 72 GLCWEAGRLRGLTIEAGLSLGDRFCLALAKREKLPAWTADRKWRDIADAAGVKVVAIR 129 >XP_003343578.1 hypothetical protein SMAC_11764 [Sordaria macrospora k-hell] CCC05778.1 unnamed protein product [Sordaria macrospora k-hell] Length = 92 Score = 80.9 bits (198), Expect = 1e-17 Identities = 41/58 (70%), Positives = 46/58 (79%) Frame = +2 Query: 2 GLSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 GL +EAG LR LTVE GLSLGDR+CLALAKRE LPA TA+R+W IA+A GV V IR Sbjct: 35 GLCWEAGRLRGLTVEAGLSLGDRFCLALAKREKLPAWTADRKWRDIADAVGVKVVAIR 92 >WP_051583537.1 twitching motility protein PilT [Sphingomonas sp. RIT328] Length = 116 Score = 80.5 bits (197), Expect = 3e-17 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 L+ EAG LR TV GGLSLGDR+CLALAKR+GLPA TA+R+W TIA+AAGV V IR Sbjct: 60 LAREAGRLRIHTVTGGLSLGDRFCLALAKRDGLPAWTADRQWKTIADAAGVKVVAIR 116 >EZP50462.1 putative toxin of toxin-antitoxin system [Sphingomonas sp. RIT328] Length = 128 Score = 80.5 bits (197), Expect = 4e-17 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 L+ EAG LR TV GGLSLGDR+CLALAKR+GLPA TA+R+W TIA+AAGV V IR Sbjct: 72 LAREAGRLRIHTVTGGLSLGDRFCLALAKRDGLPAWTADRQWKTIADAAGVKVVAIR 128 >SEP05674.1 PIN domain nuclease, a component of toxin-antitoxin system (PIN domain) [Methylobacterium sp. ap11] Length = 129 Score = 80.1 bits (196), Expect = 6e-17 Identities = 42/57 (73%), Positives = 44/57 (77%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LS AGMLRP+T+ GLSLGDRYCLALAKRE ALTAERRW IA AA V VE IR Sbjct: 73 LSVSAGMLRPITLPLGLSLGDRYCLALAKREAATALTAERRWCDIAAAAAVEVESIR 129 >WP_010890946.1 MULTISPECIES: twitching motility protein PilT [Novosphingobium] NP_049128.1 unknown [Novosphingobium aromaticivorans] AAD03924.1 unknown (plasmid) [Novosphingobium aromaticivorans] ABP64214.1 PilT protein domain protein (plasmid) [Novosphingobium aromaticivorans DSM 12444] KHS43727.1 PilT protein-like protein [Novosphingobium subterraneum] SCY85545.1 PIN domain nuclease, a component of toxin-antitoxin system (PIN domain) [Novosphingobium stygium] Length = 129 Score = 79.0 bits (193), Expect = 2e-16 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +2 Query: 2 GLSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 GL+ AG LR T E GLSLGDR+CLALA+R+GLPALTA+++W T+A AAGV V +IR Sbjct: 72 GLATIAGRLRAATAEAGLSLGDRFCLALARRDGLPALTADKQWRTVAAAAGVSVAVIR 129 >ODU67723.1 twitching motility protein PilT [Novosphingobium sp. SCN 66-18] Length = 129 Score = 78.6 bits (192), Expect = 2e-16 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = +2 Query: 17 AGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 AG LR T E GLSLGDR+CLALA+R+GLPALTA+++W T+A+AAGV V +IR Sbjct: 77 AGRLRAATAEAGLSLGDRFCLALARRDGLPALTADKQWRTVADAAGVAVTVIR 129 >WP_062343922.1 twitching motility protein PilT [Novosphingobium sp. CCH12-A3] Length = 129 Score = 78.6 bits (192), Expect = 2e-16 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = +2 Query: 17 AGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 AG LR T E GLSLGDR+CLALA+R+GLPALTA+++W T+A+AAGV V +IR Sbjct: 77 AGRLRAATAEAGLSLGDRFCLALARRDGLPALTADKQWRTVADAAGVAVTVIR 129 >WP_017502530.1 twitching motility protein PilT [Sphingobium yanoikuyae] KEZ16659.1 Twitching motility protein PilT [Sphingobium yanoikuyae] KMW29600.1 twitching motility protein PilT [Sphingobium yanoikuyae] KZC75575.1 twitching motility protein PilT [Sphingobium yanoikuyae] OJY51840.1 VapC toxin family PIN domain ribonuclease [Sphingomonas sp. 67-41] Length = 129 Score = 78.6 bits (192), Expect = 2e-16 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 L++EAG LR +T E GLSLGDR+CLALAKREG+PA TA++ W T+A+AA V V +IR Sbjct: 73 LAWEAGALRAVTAEAGLSLGDRFCLALAKREGVPAYTADQAWKTVADAAKVKVTVIR 129 >WP_056000813.1 twitching motility protein PilT [Sphingomonas sp. Leaf67] KQN83036.1 twitching motility protein PilT [Sphingomonas sp. Leaf67] Length = 129 Score = 78.2 bits (191), Expect = 3e-16 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = +2 Query: 2 GLSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 GL ++AG LR LTVE GLSLGDR+CLALA+RE LPA TA+R W IA+A GV V +IR Sbjct: 72 GLCWDAGRLRGLTVEAGLSLGDRFCLALARREKLPAWTADRTWRDIADAVGVKVVVIR 129 >WP_006949416.1 MULTISPECIES: PIN domain-containing protein [Sphingomonadaceae] YP_008494380.1 putative toxin of toxin-antitoxin system (plasmid) [Sphingomonas sp. ERG5] CCW15949.1 hypothetical protein EBBID32_2800 [Sphingobium japonicum BiD32] AGU69291.1 putative toxin of toxin-antitoxin system (plasmid) [Sphingomonas sp. ERG5] Length = 129 Score = 78.2 bits (191), Expect = 3e-16 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +2 Query: 17 AGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 AG LR T E GLSLGDR+CLALA+R+GLPALTA+ +W T+A+AAGV V +IR Sbjct: 77 AGRLRAATAEAGLSLGDRFCLALARRDGLPALTADNQWRTVADAAGVAVSVIR 129 >WP_053220997.1 hypothetical protein [Methylobacterium platani] Length = 63 Score = 76.3 bits (186), Expect = 3e-16 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LS AGMLRP+T+ GLSLGDRYCLALA+RE ALTAERRW IA A + VE IR Sbjct: 7 LSVSAGMLRPITLPLGLSLGDRYCLALARREAATALTAERRWCDIAAAVALEVETIR 63 >KMO16207.1 twitching motility protein PilT, partial [Methylobacterium platani] Length = 67 Score = 76.3 bits (186), Expect = 4e-16 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +2 Query: 5 LSYEAGMLRPLTVEGGLSLGDRYCLALAKREGLPALTAERRWSTIAEAAGVVVEMIR 175 LS AGMLRP+T+ GLSLGDRYCLALA+RE ALTAERRW IA A + VE IR Sbjct: 11 LSVSAGMLRPITLPLGLSLGDRYCLALARREAATALTAERRWCDIAAAVALEVETIR 67