BLASTX nr result
ID: Glycyrrhiza28_contig00014858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00014858 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONM31625.1 ATP-citrate synthase beta chain protein 2 [Zea mays] 121 5e-32 BAD93838.1 ATP-citrate lyase subunit B, partial [Arabidopsis tha... 122 1e-31 NP_001168033.1 uncharacterized protein LOC100381760 [Zea mays] A... 121 3e-31 XP_012483153.1 PREDICTED: ATP-citrate synthase beta chain protei... 123 1e-30 XP_016715895.1 PREDICTED: ATP-citrate synthase beta chain protei... 123 1e-30 XP_016724288.1 PREDICTED: ATP-citrate synthase beta chain protei... 121 4e-30 XP_019425314.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 GAU27741.1 hypothetical protein TSUD_215520 [Trifolium subterran... 124 7e-30 XP_016197862.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 XP_015959521.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 ABR15094.1 ATP citrate lyase alpha subunit [Glycyrrhiza uralensis] 124 7e-30 XP_007147365.1 hypothetical protein PHAVU_006G118100g [Phaseolus... 124 7e-30 XP_004486545.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 XP_006597698.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 XP_003533158.1 PREDICTED: ATP-citrate synthase beta chain protei... 124 7e-30 XP_003594738.1 ATP:citrate lyase [Medicago truncatula] ABN07962.... 124 7e-30 CAC86995.1 ATP citrate lyase a-subunit [Lupinus albus] 124 7e-30 XP_019576241.1 PREDICTED: ATP-citrate synthase beta chain protei... 122 9e-30 KRH50728.1 hypothetical protein GLYMA_07G239700 [Glycine max] 124 9e-30 KYP57881.1 putative ATP-citrate synthase [Cajanus cajan] 124 1e-29 >ONM31625.1 ATP-citrate synthase beta chain protein 2 [Zea mays] Length = 133 Score = 121 bits (303), Expect = 5e-32 Identities = 60/63 (95%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLV+NVDGAIGSLFLDLL+GSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 52 TLSKANNLVMNVDGAIGSLFLDLLSGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 111 Query: 183 FDQ 191 FDQ Sbjct: 112 FDQ 114 >BAD93838.1 ATP-citrate lyase subunit B, partial [Arabidopsis thaliana] Length = 183 Score = 122 bits (305), Expect = 1e-31 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLFVLARSIGLIGHT Sbjct: 102 TLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHT 161 Query: 183 FDQ 191 FDQ Sbjct: 162 FDQ 164 >NP_001168033.1 uncharacterized protein LOC100381760 [Zea mays] ACN26890.1 unknown [Zea mays] Length = 201 Score = 121 bits (303), Expect = 3e-31 Identities = 60/63 (95%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLV+NVDGAIGSLFLDLL+GSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 120 TLSKANNLVMNVDGAIGSLFLDLLSGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 179 Query: 183 FDQ 191 FDQ Sbjct: 180 FDQ 182 >XP_012483153.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Gossypium raimondii] KJB38341.1 hypothetical protein B456_006G250500 [Gossypium raimondii] Length = 326 Score = 123 bits (308), Expect = 1e-30 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 245 TLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 304 Query: 183 FDQ 191 FDQ Sbjct: 305 FDQ 307 >XP_016715895.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Gossypium hirsutum] Length = 328 Score = 123 bits (308), Expect = 1e-30 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 247 TLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 306 Query: 183 FDQ 191 FDQ Sbjct: 307 FDQ 309 >XP_016724288.1 PREDICTED: ATP-citrate synthase beta chain protein 2-like [Gossypium hirsutum] Length = 327 Score = 121 bits (304), Expect = 4e-30 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLVLNVDGAIGSLFLDLLAGSGMF+KQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 246 TLSKANNLVLNVDGAIGSLFLDLLAGSGMFSKQEIDEIVEIGYLNGLFVLARSIGLIGHT 305 Query: 183 FDQ 191 FDQ Sbjct: 306 FDQ 308 >XP_019425314.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Lupinus angustifolius] XP_019425315.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Lupinus angustifolius] XP_019425316.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Lupinus angustifolius] OIV91778.1 hypothetical protein TanjilG_14357 [Lupinus angustifolius] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >GAU27741.1 hypothetical protein TSUD_215520 [Trifolium subterraneum] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_016197862.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Arachis ipaensis] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_015959521.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Arachis duranensis] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >ABR15094.1 ATP citrate lyase alpha subunit [Glycyrrhiza uralensis] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_007147365.1 hypothetical protein PHAVU_006G118100g [Phaseolus vulgaris] ESW19359.1 hypothetical protein PHAVU_006G118100g [Phaseolus vulgaris] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_004486545.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Cicer arietinum] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_006597698.1 PREDICTED: ATP-citrate synthase beta chain protein 1 [Glycine max] KHN14690.1 ATP-citrate synthase beta chain protein 1 [Glycine soja] KRH11944.1 hypothetical protein GLYMA_15G140300 [Glycine max] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_003533158.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Glycine max] XP_006586889.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Glycine max] XP_006586890.1 PREDICTED: ATP-citrate synthase beta chain protein 1-like [Glycine max] KHN12868.1 ATP-citrate synthase beta chain protein 1 [Glycine soja] KRH36970.1 hypothetical protein GLYMA_09G035600 [Glycine max] KRH36971.1 hypothetical protein GLYMA_09G035600 [Glycine max] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_003594738.1 ATP:citrate lyase [Medicago truncatula] ABN07962.1 ATP-citrate lyase/succinyl-CoA ligase [Medicago truncatula] AES64989.1 ATP:citrate lyase [Medicago truncatula] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >CAC86995.1 ATP citrate lyase a-subunit [Lupinus albus] Length = 608 Score = 124 bits (312), Expect = 7e-30 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589 >XP_019576241.1 PREDICTED: ATP-citrate synthase beta chain protein 2-like, partial [Rhinolophus sinicus] Length = 385 Score = 122 bits (305), Expect = 9e-30 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TL+KANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIV+IGYLNGLFVLARSIGLIGHT Sbjct: 304 TLSKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHT 363 Query: 183 FDQ 191 FDQ Sbjct: 364 FDQ 366 >KRH50728.1 hypothetical protein GLYMA_07G239700 [Glycine max] Length = 583 Score = 124 bits (311), Expect = 9e-30 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQE+DEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 502 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEVDEIVEIGYLNGLFVLARSIGLIGHT 561 Query: 183 FDQ 191 FDQ Sbjct: 562 FDQ 564 >KYP57881.1 putative ATP-citrate synthase [Cajanus cajan] Length = 608 Score = 124 bits (311), Expect = 1e-29 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +3 Query: 3 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEIDEIVEIGYLNGLFVLARSIGLIGHT 182 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQE+DEIVEIGYLNGLFVLARSIGLIGHT Sbjct: 527 TLTKANNLVLNVDGAIGSLFLDLLAGSGMFTKQEVDEIVEIGYLNGLFVLARSIGLIGHT 586 Query: 183 FDQ 191 FDQ Sbjct: 587 FDQ 589