BLASTX nr result
ID: Glycyrrhiza28_contig00014723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00014723 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH67604.1 hypothetical protein GLYMA_03G175600 [Glycine max] 45 5e-07 >KRH67604.1 hypothetical protein GLYMA_03G175600 [Glycine max] Length = 297 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +1 Query: 58 FLLTLISTHAFAQRWLLVSAWRNSVIDYGKV 150 F T IS HAFA RWLLVSA RNSV++ GK+ Sbjct: 3 FFFTSISPHAFAPRWLLVSARRNSVVNEGKI 33 Score = 35.8 bits (81), Expect(2) = 5e-07 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +2 Query: 155 CCFPGLFLTSFGQEFSDPRD 214 C F GLFLT F QEFSDPRD Sbjct: 35 CYFIGLFLTYFEQEFSDPRD 54