BLASTX nr result
ID: Glycyrrhiza28_contig00014688
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00014688 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415537.1 hypothetical protein MELLADRAFT_92704 [Melampsora... 64 3e-10 KNE88863.1 hypothetical protein PSTG_17691, partial [Puccinia st... 60 4e-10 KDQ49121.1 hypothetical protein JAAARDRAFT_91570, partial [Jaapi... 60 4e-10 XP_006960891.1 hypothetical protein WALSEDRAFT_49590, partial [W... 57 4e-09 XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora... 58 5e-09 XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora... 58 5e-09 XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora... 58 7e-09 XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora... 58 7e-09 XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora... 58 7e-09 XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora... 58 7e-09 XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora... 58 7e-09 XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora... 58 7e-09 XP_007413084.1 hypothetical protein MELLADRAFT_90062 [Melampsora... 58 5e-08 KDQ49130.1 hypothetical protein JAAARDRAFT_74797 [Jaapia argilla... 57 6e-08 XP_007418756.1 hypothetical protein MELLADRAFT_84126 [Melampsora... 55 5e-07 KZT12313.1 hypothetical protein LAESUDRAFT_641849 [Laetiporus su... 52 8e-06 >XP_007415537.1 hypothetical protein MELLADRAFT_92704 [Melampsora larici-populina 98AG31] EGG01187.1 hypothetical protein MELLADRAFT_92704 [Melampsora larici-populina 98AG31] Length = 194 Score = 63.5 bits (153), Expect = 3e-10 Identities = 33/62 (53%), Positives = 40/62 (64%), Gaps = 9/62 (14%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI---------PFLSRASDTGLSAHAAQPKH 119 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI + ++D+ L A + P H Sbjct: 15 PQQIVATRLLYCLQYPALIQVVCKGFTPAHIFNTICNFMHQVIVSSTDSDLEAFSHNPTH 74 Query: 118 GS 113 GS Sbjct: 75 GS 76 >KNE88863.1 hypothetical protein PSTG_17691, partial [Puccinia striiformis f. sp. tritici PST-78] Length = 63 Score = 60.1 bits (144), Expect = 4e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 107 EAYFDTTNTCGTNVIVSSTDSDLEAFSRYLADDSF 3 +AY+++TN CGTN+IVSSTDSDLEAFS LADDSF Sbjct: 1 KAYYNSTNMCGTNIIVSSTDSDLEAFSHNLADDSF 35 >KDQ49121.1 hypothetical protein JAAARDRAFT_91570, partial [Jaapia argillacea MUCL 33604] Length = 63 Score = 60.1 bits (144), Expect = 4e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQRIVATRLLY LQ+PVP QVVCKGFTPAHI Sbjct: 1 PQRIVATRLLYRLQYPVPIQVVCKGFTPAHI 31 >XP_006960891.1 hypothetical protein WALSEDRAFT_49590, partial [Wallemia mellicola CBS 633.66] EIM19058.1 hypothetical protein WALSEDRAFT_49590, partial [Wallemia mellicola CBS 633.66] Length = 60 Score = 57.4 bits (137), Expect = 4e-09 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 280 RA*PQRIVATRLLYCLQHPVPNQVVCKGFTPA--HIPFL 170 +A PQ+IVATRLLYCLQ+PVP QVVCK FTPA H+ F+ Sbjct: 6 KAEPQQIVATRLLYCLQYPVPIQVVCKRFTPAIHHLSFV 44 >XP_007419458.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] EGF97270.1 hypothetical protein MELLADRAFT_86115 [Melampsora larici-populina 98AG31] Length = 98 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPAVIQVVCKGFTPAHI 55 >XP_007406910.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] EGG09856.1 hypothetical protein MELLADRAFT_95384 [Melampsora larici-populina 98AG31] Length = 85 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007417429.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] EGF99323.1 hypothetical protein MELLADRAFT_94726 [Melampsora larici-populina 98AG31] Length = 97 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 24 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 54 >XP_007417780.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] EGF98954.1 hypothetical protein MELLADRAFT_95024 [Melampsora larici-populina 98AG31] Length = 97 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 24 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 54 >XP_007416286.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] EGG00440.1 hypothetical protein MELLADRAFT_93281 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007417705.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] EGF99027.1 hypothetical protein MELLADRAFT_94968 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007410493.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] XP_007411657.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] XP_007413078.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] XP_007413995.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] XP_007414496.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] XP_007414630.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] XP_007415541.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] XP_007417444.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] XP_007418188.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] XP_007419025.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF97702.1 hypothetical protein MELLADRAFT_84534 [Melampsora larici-populina 98AG31] EGF98537.1 hypothetical protein MELLADRAFT_95620 [Melampsora larici-populina 98AG31] EGF99310.1 hypothetical protein MELLADRAFT_94743 [Melampsora larici-populina 98AG31] EGG01191.1 hypothetical protein MELLADRAFT_92709 [Melampsora larici-populina 98AG31] EGG02093.1 hypothetical protein MELLADRAFT_91699 [Melampsora larici-populina 98AG31] EGG02239.1 hypothetical protein MELLADRAFT_91572 [Melampsora larici-populina 98AG31] EGG02882.1 hypothetical protein MELLADRAFT_90621 [Melampsora larici-populina 98AG31] EGG03631.1 hypothetical protein MELLADRAFT_90051 [Melampsora larici-populina 98AG31] EGG05292.1 hypothetical protein MELLADRAFT_88130 [Melampsora larici-populina 98AG31] EGG06255.1 hypothetical protein MELLADRAFT_87414 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007411818.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] XP_007419047.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGF97685.1 hypothetical protein MELLADRAFT_84549 [Melampsora larici-populina 98AG31] EGG05065.1 hypothetical protein MELLADRAFT_88319 [Melampsora larici-populina 98AG31] Length = 98 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 25 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >XP_007413084.1 hypothetical protein MELLADRAFT_90062 [Melampsora larici-populina 98AG31] XP_007413088.1 hypothetical protein MELLADRAFT_90068 [Melampsora larici-populina 98AG31] EGG03637.1 hypothetical protein MELLADRAFT_90062 [Melampsora larici-populina 98AG31] EGG03641.1 hypothetical protein MELLADRAFT_90068 [Melampsora larici-populina 98AG31] Length = 217 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 271 PQRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 PQ+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 24 PQQIVATRLLYCLQYPALIQVVCKGFTPAHI 54 >KDQ49130.1 hypothetical protein JAAARDRAFT_74797 [Jaapia argillacea MUCL 33604] Length = 198 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 268 QRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 QRIVATRLLY LQ+PVP QVVCKGFTPAHI Sbjct: 8 QRIVATRLLYRLQYPVPIQVVCKGFTPAHI 37 >XP_007418756.1 hypothetical protein MELLADRAFT_84126 [Melampsora larici-populina 98AG31] EGF97977.1 hypothetical protein MELLADRAFT_84126 [Melampsora larici-populina 98AG31] Length = 213 Score = 55.1 bits (131), Expect = 5e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 268 QRIVATRLLYCLQHPVPNQVVCKGFTPAHI 179 Q+IVATRLLYCLQ+P QVVCKGFTPAHI Sbjct: 26 QQIVATRLLYCLQYPALIQVVCKGFTPAHI 55 >KZT12313.1 hypothetical protein LAESUDRAFT_641849 [Laetiporus sulphureus 93-53] Length = 186 Score = 51.6 bits (122), Expect = 8e-06 Identities = 30/60 (50%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = -2 Query: 176 ISIQSKRHGPFRPRRPAQTWFTAEA--YFDTTNTCGTNVIVSSTDSDLEAFSRYLADDSF 3 I+I + F RP+ + E Y +T+ TCGTNV+VSSTDS LEAFS ADDSF Sbjct: 2 IAIHKRATQAFPLGRPSPSDLVHEPKLYSNTSRTCGTNVVVSSTDSGLEAFSHNPADDSF 61