BLASTX nr result
ID: Glycyrrhiza28_contig00013869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00013869 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN17449.1 Calcium-binding mitochondrial carrier protein SCaMC-2... 129 1e-35 XP_017412124.1 PREDICTED: calcium-binding mitochondrial carrier ... 132 7e-35 BAS98519.1 Os06g0604500, partial [Oryza sativa Japonica Group] 125 1e-34 XP_016189649.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 1e-34 XP_015955759.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 1e-34 XP_016740167.1 PREDICTED: calcium-binding mitochondrial carrier ... 127 2e-34 XP_006581826.1 PREDICTED: calcium-binding mitochondrial carrier ... 128 2e-34 XP_006578744.1 PREDICTED: calcium-binding mitochondrial carrier ... 127 3e-34 AQL04414.1 Mitochondrial substrate carrier family protein [Zea m... 125 3e-34 XP_006578743.1 PREDICTED: calcium-binding mitochondrial carrier ... 127 4e-34 XP_014506052.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 4e-34 XP_014506050.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 5e-34 XP_007159945.1 hypothetical protein PHAVU_002G280600g [Phaseolus... 129 7e-34 XP_015955758.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 8e-34 KHN16895.1 Calcium-binding mitochondrial carrier protein SCaMC-2... 129 9e-34 XP_003532301.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 9e-34 XP_004503813.1 PREDICTED: calcium-binding mitochondrial carrier ... 129 1e-33 XP_003524327.2 PREDICTED: calcium-binding mitochondrial carrier ... 129 1e-33 KHN09696.1 Calcium-binding mitochondrial carrier protein SCaMC-2... 128 1e-33 XP_017638096.1 PREDICTED: calcium-binding mitochondrial carrier ... 127 1e-33 >KHN17449.1 Calcium-binding mitochondrial carrier protein SCaMC-2-A [Glycine soja] Length = 245 Score = 129 bits (323), Expect = 1e-35 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S+RYIL DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 118 LVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQ 177 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 178 VIRTRLQA 185 >XP_017412124.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Vigna angularis] XP_017412125.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Vigna angularis] XP_017412126.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Vigna angularis] XP_017412127.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Vigna angularis] Length = 500 Score = 132 bits (331), Expect = 7e-35 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG++PYAGIDLTVYDTLKDIS+RYIL DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 373 LVPSLLGIIPYAGIDLTVYDTLKDISKRYILHDSEPGPLVQLGCGTISGALGATCVYPLQ 432 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 433 VIRTRLQA 440 >BAS98519.1 Os06g0604500, partial [Oryza sativa Japonica Group] Length = 208 Score = 125 bits (314), Expect = 1e-34 Identities = 58/68 (85%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG+VPYAGIDL VY+TLKD+S+ YIL+DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 81 LVPSLLGIVPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQ 140 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 141 VIRTRLQA 148 >XP_016189649.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X2 [Arachis ipaensis] XP_016189651.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X2 [Arachis ipaensis] Length = 368 Score = 129 bits (324), Expect = 1e-34 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLK+IS+RYIL DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 241 LVPSLLGMIPYAGIDLTAYDTLKEISKRYILVDSEPGPLVQLGCGTISGALGATCVYPLQ 300 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 301 VIRTRLQA 308 >XP_015955759.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X2 [Arachis duranensis] XP_015955760.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X2 [Arachis duranensis] Length = 368 Score = 129 bits (324), Expect = 1e-34 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLK+IS+RYIL DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 241 LVPSLLGMIPYAGIDLTAYDTLKEISKRYILVDSEPGPLVQLGCGTISGALGATCVYPLQ 300 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 301 VIRTRLQA 308 >XP_016740167.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Gossypium hirsutum] Length = 282 Score = 127 bits (318), Expect = 2e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG++PYAGIDL VY+TLKD+SR YIL+DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 155 LVPSLLGIIPYAGIDLAVYETLKDLSRTYILQDSEPGPLVQLGCGTISGALGATCVYPLQ 214 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 215 VIRTRLQA 222 >XP_006581826.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like isoform X3 [Glycine max] KRH54062.1 hypothetical protein GLYMA_06G162700 [Glycine max] KRH54063.1 hypothetical protein GLYMA_06G162700 [Glycine max] Length = 352 Score = 128 bits (321), Expect = 2e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYA IDLT YDT+KDIS+RYIL+DSEPGPLVQLGCGTISGA+GATCVYPLQ Sbjct: 225 LVPSLLGMIPYAAIDLTAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQ 284 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 285 VIRTRLQA 292 >XP_006578744.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like isoform X4 [Glycine max] XP_014630336.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like isoform X4 [Glycine max] Length = 352 Score = 127 bits (320), Expect = 3e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYA IDLT YDTLKD+S+RYIL+DSEPGPLVQLGCGTISGA+GATCVYPLQ Sbjct: 225 LVPSLLGMIPYAAIDLTAYDTLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQ 284 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 285 VIRTRLQA 292 >AQL04414.1 Mitochondrial substrate carrier family protein [Zea mays] Length = 256 Score = 125 bits (314), Expect = 3e-34 Identities = 58/68 (85%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG+VPYAGIDL VY+TLKD+S+ YIL+DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 129 LVPSLLGIVPYAGIDLAVYETLKDVSKTYILKDSDPGPLVQLGCGTVSGALGATCVYPLQ 188 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 189 VIRTRLQA 196 >XP_006578743.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like isoform X3 [Glycine max] Length = 362 Score = 127 bits (320), Expect = 4e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYA IDLT YDTLKD+S+RYIL+DSEPGPLVQLGCGTISGA+GATCVYPLQ Sbjct: 235 LVPSLLGMIPYAAIDLTAYDTLKDMSKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQ 294 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 295 VIRTRLQA 302 >XP_014506052.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X2 [Vigna radiata var. radiata] Length = 480 Score = 129 bits (325), Expect = 4e-34 Identities = 61/68 (89%), Positives = 67/68 (98%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG++PYAGIDLTVYDTLKDIS++YIL DS+PGPLVQLGCGTISGALGATCVYPLQ Sbjct: 353 LVPSLLGIIPYAGIDLTVYDTLKDISKKYILHDSDPGPLVQLGCGTISGALGATCVYPLQ 412 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 413 VIRTRLQA 420 >XP_014506050.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Vigna radiata var. radiata] XP_014506051.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like isoform X1 [Vigna radiata var. radiata] Length = 500 Score = 129 bits (325), Expect = 5e-34 Identities = 61/68 (89%), Positives = 67/68 (98%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG++PYAGIDLTVYDTLKDIS++YIL DS+PGPLVQLGCGTISGALGATCVYPLQ Sbjct: 373 LVPSLLGIIPYAGIDLTVYDTLKDISKKYILHDSDPGPLVQLGCGTISGALGATCVYPLQ 432 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 433 VIRTRLQA 440 >XP_007159945.1 hypothetical protein PHAVU_002G280600g [Phaseolus vulgaris] ESW31939.1 hypothetical protein PHAVU_002G280600g [Phaseolus vulgaris] Length = 500 Score = 129 bits (324), Expect = 7e-34 Identities = 61/68 (89%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S+RYIL DS+PGPLVQLGCGTISGALGATCVYPLQ Sbjct: 373 LVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTISGALGATCVYPLQ 432 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 433 VIRTRLQA 440 >XP_015955758.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X1 [Arachis duranensis] XP_016189648.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 isoform X1 [Arachis ipaensis] Length = 505 Score = 129 bits (324), Expect = 8e-34 Identities = 62/68 (91%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLK+IS+RYIL DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 378 LVPSLLGMIPYAGIDLTAYDTLKEISKRYILVDSEPGPLVQLGCGTISGALGATCVYPLQ 437 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 438 VIRTRLQA 445 >KHN16895.1 Calcium-binding mitochondrial carrier protein SCaMC-2 [Glycine soja] Length = 492 Score = 129 bits (323), Expect = 9e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S+RYIL DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 365 LVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQ 424 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 425 VIRTRLQA 432 >XP_003532301.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B [Glycine max] KRH41045.1 hypothetical protein GLYMA_08G006900 [Glycine max] KRH41046.1 hypothetical protein GLYMA_08G006900 [Glycine max] Length = 492 Score = 129 bits (323), Expect = 9e-34 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S+RYIL DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 365 LVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQ 424 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 425 VIRTRLQA 432 >XP_004503813.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Cicer arietinum] XP_004503814.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Cicer arietinum] Length = 498 Score = 129 bits (323), Expect = 1e-33 Identities = 58/68 (85%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S++YI+ DSEPGPL+QLGCGT+SGALGATCVYPLQ Sbjct: 371 LVPSLLGMIPYAGIDLTAYDTLKDVSKKYIIHDSEPGPLIQLGCGTVSGALGATCVYPLQ 430 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 431 VIRTRLQA 438 >XP_003524327.2 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Glycine max] XP_006580382.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-B-like [Glycine max] KRH59718.1 hypothetical protein GLYMA_05G199400 [Glycine max] KRH59719.1 hypothetical protein GLYMA_05G199400 [Glycine max] Length = 500 Score = 129 bits (323), Expect = 1e-33 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYAGIDLT YDTLKD+S+RYIL DS+PGPLVQLGCGT+SGALGATCVYPLQ Sbjct: 373 LVPSLLGMIPYAGIDLTAYDTLKDLSKRYILYDSDPGPLVQLGCGTVSGALGATCVYPLQ 432 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 433 VIRTRLQA 440 >KHN09696.1 Calcium-binding mitochondrial carrier protein SCaMC-2-B [Glycine soja] Length = 450 Score = 128 bits (321), Expect = 1e-33 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLGM+PYA IDLT YDT+KDIS+RYIL+DSEPGPLVQLGCGTISGA+GATCVYPLQ Sbjct: 323 LVPSLLGMIPYAAIDLTAYDTMKDISKRYILQDSEPGPLVQLGCGTISGAVGATCVYPLQ 382 Query: 183 VIRTRLQA 206 VIRTRLQA Sbjct: 383 VIRTRLQA 390 >XP_017638096.1 PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like isoform X3 [Gossypium arboreum] Length = 410 Score = 127 bits (319), Expect = 1e-33 Identities = 60/68 (88%), Positives = 66/68 (97%) Frame = +3 Query: 3 LLPSLLGMVPYAGIDLTVYDTLKDISRRYILRDSEPGPLVQLGCGTISGALGATCVYPLQ 182 L+PSLLG++PYAGIDLTVY+TLKD SR YIL+DSEPGPLVQLGCGTISGALGATCVYPLQ Sbjct: 283 LVPSLLGIIPYAGIDLTVYETLKDFSRSYILQDSEPGPLVQLGCGTISGALGATCVYPLQ 342 Query: 183 VIRTRLQA 206 VIRTR+QA Sbjct: 343 VIRTRMQA 350