BLASTX nr result
ID: Glycyrrhiza28_contig00013233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00013233 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN46189.1 Serine/arginine-rich splicing factor 12 [Glycine soja] 69 8e-11 XP_006574390.1 PREDICTED: uncharacterized protein LOC100779321 i... 69 8e-11 XP_003544854.1 PREDICTED: serine/arginine-rich SC35-like splicin... 68 1e-10 NP_001242100.1 uncharacterized protein LOC100779321 [Glycine max... 67 2e-10 KYP75584.1 35 kDa SR repressor protein [Cajanus cajan] 64 1e-09 XP_014521746.1 PREDICTED: serine/arginine-rich SC35-like splicin... 65 2e-09 XP_014521745.1 PREDICTED: serine/arginine-rich SC35-like splicin... 65 2e-09 XP_016197214.1 PREDICTED: serine/arginine-rich SC35-like splicin... 64 5e-09 XP_015958851.1 PREDICTED: serine/arginine-rich SC35-like splicin... 64 5e-09 XP_017407780.1 PREDICTED: serine/arginine-rich SC35-like splicin... 62 2e-08 XP_012571803.1 PREDICTED: serine/arginine-rich SC35-like splicin... 55 4e-06 XP_004502204.1 PREDICTED: serine/arginine-rich SC35-like splicin... 55 5e-06 XP_007163842.1 hypothetical protein PHAVU_001G268900g [Phaseolus... 55 7e-06 >KHN46189.1 Serine/arginine-rich splicing factor 12 [Glycine soja] Length = 253 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH YNGG+RSRSQSPAKGPGRSRSP+ +RD+ RE R RSPSQ Sbjct: 198 RSYSQHNRERSFSRSPPYNGGSRSRSQSPAKGPGRSRSPSLNRDE-REPARGRSPSQ 253 >XP_006574390.1 PREDICTED: uncharacterized protein LOC100779321 isoform X1 [Glycine max] KRH72576.1 hypothetical protein GLYMA_02G220800 [Glycine max] Length = 253 Score = 68.6 bits (166), Expect = 8e-11 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH YNGG+RSRSQSPAKGPGRSRSP+ +RD+ RE R RSPSQ Sbjct: 198 RSYSQHNRERSFSRSPPYNGGSRSRSQSPAKGPGRSRSPSLNRDE-REPARGRSPSQ 253 >XP_003544854.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A [Glycine max] KRH16958.1 hypothetical protein GLYMA_14G188200 [Glycine max] Length = 249 Score = 68.2 bits (165), Expect = 1e-10 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RS+SQH YNGG+RSRSQSPAKGPG+SRSP+P+RD RE R RSPSQ Sbjct: 194 RSFSQHSRERSYSRSPPYNGGSRSRSQSPAKGPGQSRSPSPNRDG-REPARGRSPSQ 249 >NP_001242100.1 uncharacterized protein LOC100779321 [Glycine max] ACU18080.1 unknown [Glycine max] Length = 253 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH YNGG+RSRSQSPAKGPGRSRSP+ +RD+ +E R RSPSQ Sbjct: 198 RSYSQHNRERSFSRSPPYNGGSRSRSQSPAKGPGRSRSPSLNRDE-KEPARGRSPSQ 253 >KYP75584.1 35 kDa SR repressor protein [Cajanus cajan] Length = 203 Score = 64.3 bits (155), Expect = 1e-09 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQ YNGG+RSRS+SPAK PGRSRSP+P+R DVRE R RSPSQ Sbjct: 148 RSYSQQSRERSYSRSPPYNGGSRSRSRSPAKVPGRSRSPSPNR-DVREPTRGRSPSQ 203 >XP_014521746.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 isoform X2 [Vigna radiata var. radiata] Length = 239 Score = 64.7 bits (156), Expect = 2e-09 Identities = 35/57 (61%), Positives = 38/57 (66%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYS YNGG+RSRS SPAKGPGRSRSP+PD DV+E R RSPSQ Sbjct: 184 RSYSPQSRERSYSRSPAYNGGSRSRSHSPAKGPGRSRSPSPDH-DVKEPARGRSPSQ 239 >XP_014521745.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 isoform X1 [Vigna radiata var. radiata] Length = 246 Score = 64.7 bits (156), Expect = 2e-09 Identities = 35/57 (61%), Positives = 38/57 (66%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYS YNGG+RSRS SPAKGPGRSRSP+PD DV+E R RSPSQ Sbjct: 191 RSYSPQSRERSYSRSPAYNGGSRSRSHSPAKGPGRSRSPSPDH-DVKEPARGRSPSQ 246 >XP_016197214.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Arachis ipaensis] Length = 249 Score = 63.5 bits (153), Expect = 5e-09 Identities = 35/56 (62%), Positives = 37/56 (66%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPS 348 RSYS H YNGG+RSRSQSPAKGP SRSPTPDR DVRE RSP+ Sbjct: 190 RSYSHHSRERSSSRSPPYNGGSRSRSQSPAKGPTHSRSPTPDR-DVRELAARRSPA 244 >XP_015958851.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Arachis duranensis] Length = 249 Score = 63.5 bits (153), Expect = 5e-09 Identities = 35/56 (62%), Positives = 37/56 (66%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPS 348 RSYS H YNGG+RSRSQSPAKGP SRSPTPDR DVRE RSP+ Sbjct: 190 RSYSHHSRERSSSRSPPYNGGSRSRSQSPAKGPTHSRSPTPDR-DVRELAARRSPA 244 >XP_017407780.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Vigna angularis] XP_017407781.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Vigna angularis] Length = 246 Score = 61.6 bits (148), Expect = 2e-08 Identities = 34/57 (59%), Positives = 37/57 (64%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYS YNGG+RSRS SPAKGP RSRSP+PD DV+E R RSPSQ Sbjct: 191 RSYSPQSRERSYSRSPAYNGGSRSRSHSPAKGPTRSRSPSPDH-DVKEPARGRSPSQ 246 >XP_012571803.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A isoform X2 [Cicer arietinum] Length = 206 Score = 55.1 bits (131), Expect = 4e-06 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH NG RSRS SP K PG+SRS +P R DVR S SRSPSQ Sbjct: 151 RSYSQHSRERSYSHSPPNNGNARSRSPSPVKDPGQSRSQSPVR-DVRGSIHSRSPSQ 206 >XP_004502204.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A isoform X1 [Cicer arietinum] Length = 243 Score = 55.1 bits (131), Expect = 5e-06 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH NG RSRS SP K PG+SRS +P R DVR S SRSPSQ Sbjct: 188 RSYSQHSRERSYSHSPPNNGNARSRSPSPVKDPGQSRSQSPVR-DVRGSIHSRSPSQ 243 >XP_007163842.1 hypothetical protein PHAVU_001G268900g [Phaseolus vulgaris] ESW35836.1 hypothetical protein PHAVU_001G268900g [Phaseolus vulgaris] Length = 242 Score = 54.7 bits (130), Expect = 7e-06 Identities = 33/57 (57%), Positives = 35/57 (61%) Frame = -3 Query: 515 RSYSQHXXXXXXXXXXXYNGGTRSRSQSPAKGPGRSRSPTPDRDDVRESGRSRSPSQ 345 RSYSQH YNGG+RS PAK P RSRSP+PDR DVRE RSPSQ Sbjct: 191 RSYSQHSRERSYSRSPPYNGGSRS----PAKAPVRSRSPSPDR-DVRERAHDRSPSQ 242