BLASTX nr result
ID: Glycyrrhiza28_contig00012839
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00012839 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003518016.2 PREDICTED: photosynthetic NDH subunit of lumenal ... 63 1e-09 >XP_003518016.2 PREDICTED: photosynthetic NDH subunit of lumenal location 2, chloroplastic [Glycine max] KRH74903.1 hypothetical protein GLYMA_01G050900 [Glycine max] Length = 245 Score = 62.8 bits (151), Expect = 1e-09 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 4/50 (8%) Frame = -2 Query: 248 KSKFPHHHSKLK--PH--PQFDIQKTMSSFTHATTLLHAHIKTKQQRTTT 111 +SKFP HHS+L PH P+ + KTMSSFTHATTLLHAHIKTK ++ +T Sbjct: 28 ESKFPPHHSRLTYLPHTPPKPKLSKTMSSFTHATTLLHAHIKTKHKKPST 77