BLASTX nr result
ID: Glycyrrhiza28_contig00011988
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011988 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014505898.1 PREDICTED: uncharacterized protein LOC106765704 [... 60 3e-08 XP_017438716.1 PREDICTED: uncharacterized protein LOC108344746 i... 60 6e-08 XP_007151226.1 hypothetical protein PHAVU_004G028400g [Phaseolus... 55 4e-06 XP_003554887.1 PREDICTED: uncharacterized protein LOC100778657 [... 55 4e-06 XP_016194267.1 PREDICTED: uncharacterized protein LOC107635325 i... 54 7e-06 >XP_014505898.1 PREDICTED: uncharacterized protein LOC106765704 [Vigna radiata var. radiata] Length = 765 Score = 60.5 bits (145), Expect = 3e-08 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 115 FHRKMDLFSGYFWVFLSKLIQTLFWVFTKVFMRFYSPE 2 FH++MDLFS Y W+FL +L+ TLFWVFT++FMR++ E Sbjct: 18 FHQRMDLFSWYVWIFLVQLVDTLFWVFTRIFMRYFIHE 55 >XP_017438716.1 PREDICTED: uncharacterized protein LOC108344746 isoform X1 [Vigna angularis] BAU01258.1 hypothetical protein VIGAN_11045400 [Vigna angularis var. angularis] Length = 764 Score = 59.7 bits (143), Expect = 6e-08 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 115 FHRKMDLFSGYFWVFLSKLIQTLFWVFTKVFMRFYSPE 2 FH++MDLFS Y W+FL +L+ TLFWV T++FMR++S E Sbjct: 18 FHQRMDLFSWYVWIFLVQLVDTLFWVSTRIFMRYFSHE 55 >XP_007151226.1 hypothetical protein PHAVU_004G028400g [Phaseolus vulgaris] ESW23220.1 hypothetical protein PHAVU_004G028400g [Phaseolus vulgaris] Length = 720 Score = 54.7 bits (130), Expect = 4e-06 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -3 Query: 103 MDLFSGYFWVFLSKLIQTLFWVFTKVFMRFYS 8 MDLFS Y W+FLS+L+ TLFW+FT++ MR++S Sbjct: 1 MDLFSWYVWIFLSQLVDTLFWIFTRILMRYFS 32 >XP_003554887.1 PREDICTED: uncharacterized protein LOC100778657 [Glycine max] KRG93527.1 hypothetical protein GLYMA_19G022000 [Glycine max] Length = 750 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -3 Query: 103 MDLFSGYFWVFLSKLIQTLFWVFTKVFMRFYSPE 2 MDLFSGY W+FLS L++TLFW+ +++FMR+ S E Sbjct: 1 MDLFSGYVWIFLSHLVETLFWICSRIFMRYTSHE 34 >XP_016194267.1 PREDICTED: uncharacterized protein LOC107635325 isoform X1 [Arachis ipaensis] Length = 789 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 136 MGSPNGFFHRKMDLFSGYFWVFLSKLIQTLFWVFTKVFMRFYS 8 M GF + K+ L + YF V SKL+Q+LFWVFTK+FMR+YS Sbjct: 3 MSYSKGFLNPKVVLLTEYFCVLFSKLMQSLFWVFTKIFMRYYS 45