BLASTX nr result
ID: Glycyrrhiza28_contig00011803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011803 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013468247.1 PPR containing plant-like protein [Medicago trunc... 82 3e-16 XP_004497461.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-16 GAU26737.1 hypothetical protein TSUD_317350 [Trifolium subterran... 82 3e-16 XP_019443046.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 9e-16 XP_016178462.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 9e-16 KHN39110.1 Pentatricopeptide repeat-containing protein, chloropl... 79 2e-15 KOM34801.1 hypothetical protein LR48_Vigan02g095100 [Vigna angul... 79 3e-15 XP_014491929.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 3e-15 XP_003536980.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 3e-15 XP_015945516.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-15 XP_010244995.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-15 XP_008239177.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 4e-15 XP_007206428.1 hypothetical protein PRUPE_ppa001926mg [Prunus pe... 79 4e-15 KDO36285.1 hypothetical protein CISIN_1g007970mg [Citrus sinensis] 78 6e-15 XP_007144529.1 hypothetical protein PHAVU_007G163500g [Phaseolus... 78 6e-15 XP_006428878.1 hypothetical protein CICLE_v10011148mg [Citrus cl... 78 6e-15 KYP43927.1 hypothetical protein KK1_034609 [Cajanus cajan] 78 8e-15 CBI32614.3 unnamed protein product, partial [Vitis vinifera] 78 8e-15 XP_009358186.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 8e-15 XP_008369807.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 8e-15 >XP_013468247.1 PPR containing plant-like protein [Medicago truncatula] KEH42284.1 PPR containing plant-like protein [Medicago truncatula] Length = 719 Score = 81.6 bits (200), Expect = 3e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DGY Sbjct: 682 QDRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPLDGY 718 >XP_004497461.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Cicer arietinum] Length = 732 Score = 81.6 bits (200), Expect = 3e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DGY Sbjct: 691 QDRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPLDGY 727 >GAU26737.1 hypothetical protein TSUD_317350 [Trifolium subterraneum] Length = 735 Score = 81.6 bits (200), Expect = 3e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DGY Sbjct: 698 QDRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPLDGY 734 >XP_019443046.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Lupinus angustifolius] OIW12124.1 hypothetical protein TanjilG_02345 [Lupinus angustifolius] Length = 743 Score = 80.5 bits (197), Expect = 9e-16 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 Q RR+ERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY Sbjct: 706 QQRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 742 >XP_016178462.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Arachis ipaensis] Length = 346 Score = 79.7 bits (195), Expect = 9e-16 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP++GY Sbjct: 304 QDRRIERKRAAEAFKFWLGLPNSYYGSEWRLEPIEGY 340 >KHN39110.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 363 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR+ERKRAAEAFKFWLGLPNSYY GSEWRLEPM+GYG Sbjct: 319 QDRRVERKRAAEAFKFWLGLPNSYYDGSEWRLEPMEGYG 357 >KOM34801.1 hypothetical protein LR48_Vigan02g095100 [Vigna angularis] BAT95845.1 hypothetical protein VIGAN_08266100 [Vigna angularis var. angularis] Length = 709 Score = 79.0 bits (193), Expect = 3e-15 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR+ERKRAAEAFKFWLGLPNSYY GSEWRLEPM+GYG Sbjct: 665 QDRRIERKRAAEAFKFWLGLPNSYYDGSEWRLEPMEGYG 703 >XP_014491929.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Vigna radiata var. radiata] Length = 710 Score = 79.0 bits (193), Expect = 3e-15 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR+ERKRAAEAFKFWLGLPNSYY GSEWRLEPM+GYG Sbjct: 666 QDRRIERKRAAEAFKFWLGLPNSYYDGSEWRLEPMEGYG 704 >XP_003536980.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Glycine max] KRH32402.1 hypothetical protein GLYMA_10G049200 [Glycine max] Length = 716 Score = 79.0 bits (193), Expect = 3e-15 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR+ERKRAAEAFKFWLGLPNSYY GSEWRLEPM+GYG Sbjct: 672 QDRRVERKRAAEAFKFWLGLPNSYYDGSEWRLEPMEGYG 710 >XP_015945516.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Arachis duranensis] Length = 727 Score = 78.6 bits (192), Expect = 4e-15 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDGY 113 QDRR+ER+RAAEAFKFWLGLPNSYYGSEWRLEP++GY Sbjct: 685 QDRRIERRRAAEAFKFWLGLPNSYYGSEWRLEPIEGY 721 >XP_010244995.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Nelumbo nucifera] Length = 728 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEP DG Sbjct: 685 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPDDG 720 >XP_008239177.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Prunus mume] Length = 730 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DG Sbjct: 693 QDRRIERKRAAEAFKFWLGLPNSYYGSEWRLEPIDG 728 >XP_007206428.1 hypothetical protein PRUPE_ppa001926mg [Prunus persica] ONI03149.1 hypothetical protein PRUPE_6G241600 [Prunus persica] Length = 740 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR+ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DG Sbjct: 703 QDRRIERKRAAEAFKFWLGLPNSYYGSEWRLEPIDG 738 >KDO36285.1 hypothetical protein CISIN_1g007970mg [Citrus sinensis] Length = 583 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR ERKRAAEAFKFWLGLPNSYYGSEWRL+PMDG Sbjct: 539 QDRRRERKRAAEAFKFWLGLPNSYYGSEWRLDPMDG 574 >XP_007144529.1 hypothetical protein PHAVU_007G163500g [Phaseolus vulgaris] ESW16523.1 hypothetical protein PHAVU_007G163500g [Phaseolus vulgaris] Length = 713 Score = 78.2 bits (191), Expect = 6e-15 Identities = 36/39 (92%), Positives = 37/39 (94%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR ERKRAAEAFKFWLGLPNSYY GSEWRLEPM+GYG Sbjct: 669 QDRRTERKRAAEAFKFWLGLPNSYYDGSEWRLEPMEGYG 707 >XP_006428878.1 hypothetical protein CICLE_v10011148mg [Citrus clementina] XP_006480600.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Citrus sinensis] XP_015386535.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Citrus sinensis] ESR42118.1 hypothetical protein CICLE_v10011148mg [Citrus clementina] Length = 740 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR ERKRAAEAFKFWLGLPNSYYGSEWRL+PMDG Sbjct: 696 QDRRRERKRAAEAFKFWLGLPNSYYGSEWRLDPMDG 731 >KYP43927.1 hypothetical protein KK1_034609 [Cajanus cajan] Length = 657 Score = 77.8 bits (190), Expect = 8e-15 Identities = 35/39 (89%), Positives = 38/39 (97%), Gaps = 1/39 (2%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYY-GSEWRLEPMDGYG 116 QDRR+ERKRAAEAFKFWLGLPNSYY GSEWRLEP++GYG Sbjct: 613 QDRRVERKRAAEAFKFWLGLPNSYYDGSEWRLEPLEGYG 651 >CBI32614.3 unnamed protein product, partial [Vitis vinifera] Length = 723 Score = 77.8 bits (190), Expect = 8e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DG Sbjct: 669 QDRRSERKRAAEAFKFWLGLPNSYYGSEWRLEPIDG 704 >XP_009358186.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Pyrus x bretschneideri] Length = 741 Score = 77.8 bits (190), Expect = 8e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DG Sbjct: 704 QDRRSERKRAAEAFKFWLGLPNSYYGSEWRLEPIDG 739 >XP_008369807.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic [Malus domestica] Length = 741 Score = 77.8 bits (190), Expect = 8e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 QDRRMERKRAAEAFKFWLGLPNSYYGSEWRLEPMDG 110 QDRR ERKRAAEAFKFWLGLPNSYYGSEWRLEP+DG Sbjct: 704 QDRRSERKRAAEAFKFWLGLPNSYYGSEWRLEPIDG 739