BLASTX nr result
ID: Glycyrrhiza28_contig00011611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011611 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19275.1 hypothetical protein TSUD_335600 [Trifolium subterran... 66 2e-10 XP_013444455.1 hypothetical protein MTR_8g020965 [Medicago trunc... 51 3e-06 >GAU19275.1 hypothetical protein TSUD_335600 [Trifolium subterraneum] Length = 438 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 4/40 (10%) Frame = -2 Query: 108 HGRLNRQRPVPHSQHP----LQSRAISPLARRSSFRSSST 1 HGRLNRQRPVPHSQH +QSRAISPLARRSSFRSSST Sbjct: 385 HGRLNRQRPVPHSQHAPLPYIQSRAISPLARRSSFRSSST 424 >XP_013444455.1 hypothetical protein MTR_8g020965 [Medicago truncatula] KEH18480.1 hypothetical protein MTR_8g020965 [Medicago truncatula] Length = 81 Score = 51.2 bits (121), Expect = 3e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 111 VHGRLNRQRPVPHSQHPLQSRAISP 37 VHGRLNRQRPVPHSQHPLQ AISP Sbjct: 57 VHGRLNRQRPVPHSQHPLQYWAISP 81