BLASTX nr result
ID: Glycyrrhiza28_contig00011372
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011372 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015936390.1 PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-r... 53 3e-06 XP_016169667.1 PREDICTED: putative receptor-like protein kinase ... 52 7e-06 >XP_015936390.1 PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Arachis duranensis] Length = 1403 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 249 SEVDLPQPKLPSFYIGEPSDGTXXXXSKNKLSITVMEAR 133 SEVDLPQPK P+F++ EP DG+ KN+LSIT MEAR Sbjct: 524 SEVDLPQPKAPTFFLCEPFDGSSSSTCKNELSITEMEAR 562 >XP_016169667.1 PREDICTED: putative receptor-like protein kinase At4g00960 [Arachis ipaensis] Length = 567 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 249 SEVDLPQPKLPSFYIGEPSDGTXXXXSKNKLSITVMEAR 133 SE+DLPQPK P F+I +P DG+ SKN+LSIT MEAR Sbjct: 529 SEIDLPQPKAPKFFICDPFDGSSTSISKNELSITEMEAR 567