BLASTX nr result
ID: Glycyrrhiza28_contig00011274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011274 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607703.1 thioredoxin [Medicago truncatula] AES89900.1 thio... 63 4e-10 AFK41569.1 unknown [Medicago truncatula] 62 8e-10 KYP53466.1 Thioredoxin-like 4 [Cajanus cajan] 60 5e-09 KHN47842.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH5561... 60 7e-09 NP_001237912.1 uncharacterized protein LOC100306379 [Glycine max... 59 3e-08 KHN39925.1 Thioredoxin-like protein CXXS1 [Glycine soja] 59 4e-08 XP_007149691.1 hypothetical protein PHAVU_005G090900g [Phaseolus... 57 7e-08 KRH27112.1 hypothetical protein GLYMA_12G215000 [Glycine max] 57 8e-08 KYP47110.1 Thioredoxin-like 4 [Cajanus cajan] 57 9e-08 KRH33304.1 hypothetical protein GLYMA_10G114400 [Glycine max] 57 1e-07 NP_001239956.1 uncharacterized protein LOC100813627 [Glycine max... 57 1e-07 XP_019436074.1 PREDICTED: thioredoxin-like protein CXXS1 [Lupinu... 56 3e-07 NP_001237001.1 uncharacterized protein LOC100499858 [Glycine max... 55 4e-07 XP_007021088.2 PREDICTED: thioredoxin-like protein CXXS1 [Theobr... 55 7e-07 EOY12613.1 Thioredoxin [Theobroma cacao] 55 7e-07 XP_004505427.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer ... 54 1e-06 NP_001236552.1 uncharacterized protein LOC100500083 [Glycine max... 54 1e-06 XP_011048282.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 53 2e-06 XP_011048281.1 PREDICTED: thioredoxin-like protein CXXS1 isoform... 53 3e-06 OIV99165.1 hypothetical protein TanjilG_19661 [Lupinus angustifo... 53 3e-06 >XP_003607703.1 thioredoxin [Medicago truncatula] AES89900.1 thioredoxin [Medicago truncatula] Length = 126 Score = 63.2 bits (152), Expect = 4e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 FLLMSGG VEK VGANPDEIRKR+D FI+Q HSSK+L Sbjct: 89 FLLMSGGTPVEKAVGANPDEIRKRMDHFINQTHSSKSL 126 >AFK41569.1 unknown [Medicago truncatula] Length = 126 Score = 62.4 bits (150), Expect = 8e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 FLLMSGG VEK VGANPDEIRKR+D FI Q HSSK+L Sbjct: 89 FLLMSGGTPVEKAVGANPDEIRKRMDHFISQTHSSKSL 126 >KYP53466.1 Thioredoxin-like 4 [Cajanus cajan] Length = 128 Score = 60.5 bits (145), Expect = 5e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKN 314 F+LM+GGA V K VGANPDEIRKR+D FIHQ HS K+ Sbjct: 89 FVLMNGGAPVNKTVGANPDEIRKRIDCFIHQTHSPKS 125 >KHN47842.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH55615.1 hypothetical protein GLYMA_06G266700 [Glycine max] Length = 126 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 F LM+GGA V+KIVGANPDE+RKR++ FIHQ HS K++ Sbjct: 89 FCLMNGGAPVDKIVGANPDELRKRINCFIHQKHSPKSV 126 >NP_001237912.1 uncharacterized protein LOC100306379 [Glycine max] ACU14521.1 unknown [Glycine max] Length = 126 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 F LM+GGA V+KIVGANPDE+RKR++ FIHQ HS +++ Sbjct: 89 FCLMNGGAPVDKIVGANPDELRKRINCFIHQKHSPESV 126 >KHN39925.1 Thioredoxin-like protein CXXS1 [Glycine soja] Length = 147 Score = 58.5 bits (140), Expect = 4e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 F LM+GGA ++KIVGANPDE+RKR+ FIHQ HS K++ Sbjct: 110 FCLMNGGAPMDKIVGANPDELRKRISCFIHQKHSPKSV 147 >XP_007149691.1 hypothetical protein PHAVU_005G090900g [Phaseolus vulgaris] ESW21685.1 hypothetical protein PHAVU_005G090900g [Phaseolus vulgaris] Length = 126 Score = 57.4 bits (137), Expect = 7e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKN 314 FLL+SGG VEKIVGANPDEIRKR+D +H N S K+ Sbjct: 89 FLLLSGGTPVEKIVGANPDEIRKRIDHLVHSNPSYKS 125 >KRH27112.1 hypothetical protein GLYMA_12G215000 [Glycine max] Length = 100 Score = 56.6 bits (135), Expect = 8e-08 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 FLL+SGG ++KIVGANPDEIRKR+D F++ HS K++ Sbjct: 63 FLLLSGGTPMDKIVGANPDEIRKRIDHFVNSTHSYKSV 100 >KYP47110.1 Thioredoxin-like 4 [Cajanus cajan] Length = 123 Score = 57.0 bits (136), Expect = 9e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHS 323 F+L+SGG TV+KIVGANPDEIRKR+D FIH + S Sbjct: 89 FVLLSGGTTVDKIVGANPDEIRKRIDHFIHSHKS 122 >KRH33304.1 hypothetical protein GLYMA_10G114400 [Glycine max] Length = 126 Score = 56.6 bits (135), Expect = 1e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 F LM+GGA ++KIVGANPDE+RKR+ FIH HS K++ Sbjct: 89 FCLMNGGAPMDKIVGANPDELRKRISCFIHHKHSPKSV 126 >NP_001239956.1 uncharacterized protein LOC100813627 [Glycine max] ACU24446.1 unknown [Glycine max] KHN27979.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH27111.1 hypothetical protein GLYMA_12G215000 [Glycine max] Length = 126 Score = 56.6 bits (135), Expect = 1e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 FLL+SGG ++KIVGANPDEIRKR+D F++ HS K++ Sbjct: 89 FLLLSGGTPMDKIVGANPDEIRKRIDHFVNSTHSYKSV 126 >XP_019436074.1 PREDICTED: thioredoxin-like protein CXXS1 [Lupinus angustifolius] Length = 126 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSK 317 FLL+SGG V+KIVGANPDE++KRVD FIH S+K Sbjct: 89 FLLLSGGDPVDKIVGANPDEVKKRVDHFIHSTSSNK 124 >NP_001237001.1 uncharacterized protein LOC100499858 [Glycine max] ACU13936.1 unknown [Glycine max] KHN36735.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH22228.1 hypothetical protein GLYMA_13G286600 [Glycine max] Length = 122 Score = 55.5 bits (132), Expect = 4e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHS 323 FLL+SGG V+KIVGANPDEIRKR+D F+H S Sbjct: 89 FLLLSGGTPVDKIVGANPDEIRKRIDHFVHSTRS 122 >XP_007021088.2 PREDICTED: thioredoxin-like protein CXXS1 [Theobroma cacao] Length = 126 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSK 317 FLLMS G+ V+K+VGANPDEIRKRV+ F HQ SSK Sbjct: 89 FLLMSQGSQVDKLVGANPDEIRKRVNGFAHQIRSSK 124 >EOY12613.1 Thioredoxin [Theobroma cacao] Length = 126 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSK 317 FLLMS G+ V+K+VGANPDEIRKRV+ F HQ SSK Sbjct: 89 FLLMSQGSQVDKLVGANPDEIRKRVNGFAHQIRSSK 124 >XP_004505427.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] XP_004505428.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] XP_004505429.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] XP_004505430.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] XP_012572614.1 PREDICTED: thioredoxin-like protein CXXS1 [Cicer arietinum] Length = 133 Score = 54.3 bits (129), Expect = 1e-06 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNLTLMHEH-IEQSLPQL 269 FLLMSG V+K VGANP+EIRKR+D FIHQ L L H EQ+LP+L Sbjct: 86 FLLMSGRTPVDKAVGANPNEIRKRLDHFIHQ-----KLVLSPNHSTEQNLPEL 133 >NP_001236552.1 uncharacterized protein LOC100500083 [Glycine max] ACU14856.1 unknown [Glycine max] KHN20441.1 Thioredoxin-like protein CXXS1 [Glycine soja] KRH25890.1 hypothetical protein GLYMA_12G136400 [Glycine max] Length = 126 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSKNL 311 FLLM+ GA V+K VGANPDE+RKR++ IHQ HS K++ Sbjct: 89 FLLMNRGALVDKTVGANPDELRKRINCSIHQTHSPKSV 126 >XP_011048282.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X2 [Populus euphratica] Length = 102 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSK 317 FLLM GGA V+K+VGANPDEIR+R+ F+H H K Sbjct: 65 FLLMMGGARVDKLVGANPDEIRRRIGGFVHTVHGYK 100 >XP_011048281.1 PREDICTED: thioredoxin-like protein CXXS1 isoform X1 [Populus euphratica] Length = 126 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHSSK 317 FLLM GGA V+K+VGANPDEIR+R+ F+H H K Sbjct: 89 FLLMMGGARVDKLVGANPDEIRRRIGGFVHTVHGYK 124 >OIV99165.1 hypothetical protein TanjilG_19661 [Lupinus angustifolius] Length = 129 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 424 FLLMSGGATVEKIVGANPDEIRKRVDSFIHQNHS 323 F+LMSGGA V KIVGANPDE+RK ++ FI Q HS Sbjct: 89 FVLMSGGAQVNKIVGANPDELRKIIEHFIQQTHS 122