BLASTX nr result
ID: Glycyrrhiza28_contig00011215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011215 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620744.1 hypothetical protein MTR_6g089920 [Medicago trunc... 82 4e-18 XP_013452764.1 rhoptry associated membrane antigen, putative [Me... 64 3e-10 >XP_003620744.1 hypothetical protein MTR_6g089920 [Medicago truncatula] AES76962.1 hypothetical protein MTR_6g089920 [Medicago truncatula] Length = 134 Score = 82.0 bits (201), Expect = 4e-18 Identities = 45/88 (51%), Positives = 63/88 (71%), Gaps = 13/88 (14%) Frame = +1 Query: 34 MEELKEEYLENLRKSNDIEEIQQLLEQLKIIEDDNNQI--QKIEQNQTPKENNENEEIIL 207 ME +K EY+E++R+SNDIEEI+QL+EQLKI+E++N I +K+E+ +T ENEE+IL Sbjct: 1 MEGIKTEYMESIRRSNDIEEIKQLMEQLKIVEEENKPISLEKVEKIET---KEENEEVIL 57 Query: 208 AYTSS-----------SDSEYDEIFMEK 258 Y SS SDS++DEIFME+ Sbjct: 58 NYNSSDLEYEIGSNVGSDSDFDEIFMER 85 >XP_013452764.1 rhoptry associated membrane antigen, putative [Medicago truncatula] KEH26792.1 rhoptry associated membrane antigen, putative [Medicago truncatula] Length = 289 Score = 64.3 bits (155), Expect = 3e-10 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 11/81 (13%) Frame = +1 Query: 34 MEELKEEYLENLRKSNDIEEIQQLLEQLKIIEDDNNQIQKIEQNQTPKENN--------- 186 ME +K E +E KSNDI +I Q EQLKI+E +N IQK+E +T +N Sbjct: 23 MEGIKNESIETSTKSNDINKILQSFEQLKIVEKENKNIQKLEPAETSDDNEVTLGYTTSE 82 Query: 187 --ENEEIILAYTSSSDSEYDE 243 +NEE+IL YT+S +S +E Sbjct: 83 ELDNEEVILGYTTSEESYINE 103