BLASTX nr result
ID: Glycyrrhiza28_contig00011059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011059 (471 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH51734.1 hypothetical protein GLYMA_06G026000 [Glycine max] KR... 57 9e-07 >KRH51734.1 hypothetical protein GLYMA_06G026000 [Glycine max] KRH51735.1 hypothetical protein GLYMA_06G026000 [Glycine max] Length = 401 Score = 57.4 bits (137), Expect = 9e-07 Identities = 38/82 (46%), Positives = 48/82 (58%) Frame = -3 Query: 280 DVAAPTSELNFITFSARVFSQPSPETS*SILIKSMEGVNQSSMHRTSSCAFGSSPVVPTP 101 D +A ++L+F+ RVFS S L++SMEGV+Q + S AFG VP P Sbjct: 8 DSSATLTQLDFLLCRDRVFSIILCSLSHQ-LVESMEGVDQRN-----SSAFGVP--VPRP 59 Query: 100 PNLKPGIPPSHPNINVLTSTPP 35 PN K GIPPSHPNIN+ S P Sbjct: 60 PNQKHGIPPSHPNINISPSATP 81