BLASTX nr result
ID: Glycyrrhiza28_contig00011022
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00011022 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP41479.1 putative serine/threonine-protein kinase DDB-G0279405... 57 3e-07 GAU15635.1 hypothetical protein TSUD_108940 [Trifolium subterran... 55 8e-07 XP_004487125.1 PREDICTED: serine/threonine-protein kinase GRIK1-... 55 1e-06 XP_007152040.1 hypothetical protein PHAVU_004G096700g [Phaseolus... 55 1e-06 KHN32080.1 Putative serine/threonine-protein kinase [Glycine soja] 53 7e-06 XP_003539716.2 PREDICTED: serine/threonine-protein kinase GRIK1-... 53 7e-06 XP_006592216.1 PREDICTED: serine/threonine-protein kinase GRIK1-... 53 7e-06 XP_007132243.1 hypothetical protein PHAVU_011G078300g [Phaseolus... 52 9e-06 >KYP41479.1 putative serine/threonine-protein kinase DDB-G0279405 [Cajanus cajan] Length = 408 Score = 56.6 bits (135), Expect = 3e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESNVLA 91 GNDGPI EYLCWCKRKS+ +EDF+ SN+LA Sbjct: 379 GNDGPIPEYLCWCKRKSLVTEDFNGSNILA 408 >GAU15635.1 hypothetical protein TSUD_108940 [Trifolium subterraneum] Length = 426 Score = 55.5 bits (132), Expect = 8e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESNVL 88 GNDGPI EY CWCKRKS+ SEDF ESNVL Sbjct: 397 GNDGPIGEYSCWCKRKSVVSEDFGESNVL 425 >XP_004487125.1 PREDICTED: serine/threonine-protein kinase GRIK1-like [Cicer arietinum] Length = 410 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESNVL 88 GNDGPI EY CWCKRKS+ SEDF+ES+VL Sbjct: 381 GNDGPIGEYSCWCKRKSLVSEDFEESDVL 409 >XP_007152040.1 hypothetical protein PHAVU_004G096700g [Phaseolus vulgaris] XP_007152041.1 hypothetical protein PHAVU_004G096700g [Phaseolus vulgaris] ESW24034.1 hypothetical protein PHAVU_004G096700g [Phaseolus vulgaris] ESW24035.1 hypothetical protein PHAVU_004G096700g [Phaseolus vulgaris] Length = 409 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESNVLA 91 GNDGPI YLCWCKRKS+ +EDFD SN LA Sbjct: 380 GNDGPIPGYLCWCKRKSLVAEDFDGSNTLA 409 >KHN32080.1 Putative serine/threonine-protein kinase [Glycine soja] Length = 408 Score = 52.8 bits (125), Expect = 7e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESN 82 G+DGPI +YLCWCKRKS+G ED DESN Sbjct: 380 GDDGPIPDYLCWCKRKSLGIEDNDESN 406 >XP_003539716.2 PREDICTED: serine/threonine-protein kinase GRIK1-like isoform X2 [Glycine max] KRH24881.1 hypothetical protein GLYMA_12G068500 [Glycine max] KRH24882.1 hypothetical protein GLYMA_12G068500 [Glycine max] Length = 408 Score = 52.8 bits (125), Expect = 7e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESN 82 G+DGPI +YLCWCKRKS+G ED DESN Sbjct: 380 GDDGPIPDYLCWCKRKSLGIEDNDESN 406 >XP_006592216.1 PREDICTED: serine/threonine-protein kinase GRIK1-like isoform X1 [Glycine max] XP_006592217.1 PREDICTED: serine/threonine-protein kinase GRIK1-like isoform X1 [Glycine max] KRH24883.1 hypothetical protein GLYMA_12G068500 [Glycine max] KRH24884.1 hypothetical protein GLYMA_12G068500 [Glycine max] Length = 409 Score = 52.8 bits (125), Expect = 7e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDESN 82 G+DGPI +YLCWCKRKS+G ED DESN Sbjct: 381 GDDGPIPDYLCWCKRKSLGIEDNDESN 407 >XP_007132243.1 hypothetical protein PHAVU_011G078300g [Phaseolus vulgaris] ESW04237.1 hypothetical protein PHAVU_011G078300g [Phaseolus vulgaris] Length = 412 Score = 52.4 bits (124), Expect = 9e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +2 Query: 2 GNDGPITEYLCWCKRKSMGSEDFDES 79 G+DGPI EYLCWCKRKS+G ED DES Sbjct: 384 GDDGPIPEYLCWCKRKSLGIEDHDES 409