BLASTX nr result
ID: Glycyrrhiza28_contig00010943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00010943 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP39022.1 hypothetical protein KK1_039695 [Cajanus cajan] 57 1e-08 XP_017439668.1 PREDICTED: probable cyclic nucleotide-gated ion c... 59 5e-08 XP_007210351.1 hypothetical protein PRUPE_ppa001680mg [Prunus pe... 58 9e-08 XP_008240379.1 PREDICTED: probable cyclic nucleotide-gated ion c... 58 9e-08 ONI09488.1 hypothetical protein PRUPE_5G240800 [Prunus persica] 58 1e-07 XP_014512059.1 PREDICTED: LOW QUALITY PROTEIN: probable cyclic n... 58 1e-07 XP_012567211.1 PREDICTED: probable cyclic nucleotide-gated ion c... 57 2e-07 XP_007152601.1 hypothetical protein PHAVU_004G143800g [Phaseolus... 57 3e-07 XP_004515246.1 PREDICTED: probable cyclic nucleotide-gated ion c... 57 3e-07 EPS69229.1 hypothetical protein M569_05538, partial [Genlisea au... 56 3e-07 KRH38949.1 hypothetical protein GLYMA_09G168500 [Glycine max] 56 4e-07 KHN43679.1 Putative cyclic nucleotide-gated ion channel 20, chlo... 56 4e-07 XP_016203339.1 PREDICTED: probable cyclic nucleotide-gated ion c... 56 4e-07 XP_015966822.1 PREDICTED: probable cyclic nucleotide-gated ion c... 56 4e-07 KYP39023.1 hypothetical protein KK1_039696 [Cajanus cajan] 56 4e-07 KRH38950.1 hypothetical protein GLYMA_09G168500 [Glycine max] KR... 56 4e-07 XP_015966821.1 PREDICTED: probable cyclic nucleotide-gated ion c... 56 4e-07 XP_003534111.2 PREDICTED: uncharacterized protein LOC100794895 [... 56 4e-07 AJC00855.1 cyclic nucleotide gated channel CNGC15 [Solanum lycop... 56 6e-07 XP_013452800.1 cyclic nucleotide gated channel protein [Medicago... 56 6e-07 >KYP39022.1 hypothetical protein KK1_039695 [Cajanus cajan] Length = 92 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSK 198 NWAATRGV +E ++ENLPEDLQTDIRRHL K Sbjct: 49 NWAATRGVNEEMLMENLPEDLQTDIRRHLFK 79 >XP_017439668.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Vigna angularis] KOM54555.1 hypothetical protein LR48_Vigan10g044700 [Vigna angularis] BAU02618.1 hypothetical protein VIGAN_11217300 [Vigna angularis var. angularis] Length = 765 Score = 58.9 bits (141), Expect = 5e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHL 204 NWAATRGV +ET+LENLPEDLQTDIRRHL Sbjct: 559 NWAATRGVNEETLLENLPEDLQTDIRRHL 587 >XP_007210351.1 hypothetical protein PRUPE_ppa001680mg [Prunus persica] ONI09486.1 hypothetical protein PRUPE_5G240800 [Prunus persica] ONI09487.1 hypothetical protein PRUPE_5G240800 [Prunus persica] Length = 781 Score = 58.2 bits (139), Expect = 9e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 568 NWAATRGVNEEILLENLPEDLQTDIRRHLFKFIKKVRI 605 >XP_008240379.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Prunus mume] XP_016651249.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Prunus mume] Length = 783 Score = 58.2 bits (139), Expect = 9e-08 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 568 NWAATRGVNEEILLENLPEDLQTDIRRHLFKFIKKVRI 605 >ONI09488.1 hypothetical protein PRUPE_5G240800 [Prunus persica] Length = 613 Score = 57.8 bits (138), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSK 198 NWAATRGV +E +LENLPEDLQTDIRRHL K Sbjct: 568 NWAATRGVNEEILLENLPEDLQTDIRRHLFK 598 >XP_014512059.1 PREDICTED: LOW QUALITY PROTEIN: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Vigna radiata var. radiata] Length = 1244 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHL 204 NWAATRGV ++T+LENLPEDLQTDIRRHL Sbjct: 559 NWAATRGVNEDTLLENLPEDLQTDIRRHL 587 Score = 55.5 bits (132), Expect = 8e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAAT+GV +E +LENLPEDLQ DIRRHL K + V + Sbjct: 1033 NWAATKGVNEEMILENLPEDLQRDIRRHLFKFVKKVRI 1070 >XP_012567211.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Cicer arietinum] Length = 712 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHL 204 NWAATRGV +ET+LENLPEDLQT+IRRHL Sbjct: 503 NWAATRGVNEETLLENLPEDLQTEIRRHL 531 >XP_007152601.1 hypothetical protein PHAVU_004G143800g [Phaseolus vulgaris] ESW24595.1 hypothetical protein PHAVU_004G143800g [Phaseolus vulgaris] Length = 767 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHL 204 NWAATRGV +E +LENLPEDLQTDIRRHL Sbjct: 559 NWAATRGVNEEMLLENLPEDLQTDIRRHL 587 >XP_004515246.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Cicer arietinum] Length = 770 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV + VLENLPEDLQTDIRRHL K ++V + Sbjct: 558 NWAATRGVPEIMVLENLPEDLQTDIRRHLFKFVENVRI 595 >EPS69229.1 hypothetical protein M569_05538, partial [Genlisea aurea] Length = 291 Score = 56.2 bits (134), Expect = 3e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 +WAATRGV +ET++ENLPEDLQ DIRRHL K + V L Sbjct: 176 SWAATRGVNEETLMENLPEDLQKDIRRHLFKFVKKVRL 213 >KRH38949.1 hypothetical protein GLYMA_09G168500 [Glycine max] Length = 706 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 +WAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 496 SWAATRGVNEEILLENLPEDLQTDIRRHLFKFVKKVRI 533 >KHN43679.1 Putative cyclic nucleotide-gated ion channel 20, chloroplastic [Glycine soja] Length = 721 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 +WAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 511 SWAATRGVNEEILLENLPEDLQTDIRRHLFKFVKKVRI 548 >XP_016203339.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Arachis ipaensis] XP_016203340.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Arachis ipaensis] Length = 766 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQ DIRRHL K + V + Sbjct: 557 NWAATRGVNEEVLLENLPEDLQRDIRRHLFKFVKKVRI 594 >XP_015966822.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] XP_015966823.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] XP_015966824.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Arachis duranensis] Length = 766 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQ DIRRHL K + V + Sbjct: 557 NWAATRGVNEEVLLENLPEDLQRDIRRHLFKFVKKVRI 594 >KYP39023.1 hypothetical protein KK1_039696 [Cajanus cajan] Length = 770 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSK 198 NWAATRGV +E +LENLPEDLQT+IRRHL K Sbjct: 560 NWAATRGVNEEMLLENLPEDLQTEIRRHLFK 590 >KRH38950.1 hypothetical protein GLYMA_09G168500 [Glycine max] KRH38951.1 hypothetical protein GLYMA_09G168500 [Glycine max] Length = 770 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 +WAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 560 SWAATRGVNEEILLENLPEDLQTDIRRHLFKFVKKVRI 597 >XP_015966821.1 PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Arachis duranensis] Length = 784 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQ DIRRHL K + V + Sbjct: 575 NWAATRGVNEEVLLENLPEDLQRDIRRHLFKFVKKVRI 612 >XP_003534111.2 PREDICTED: uncharacterized protein LOC100794895 [Glycine max] Length = 1552 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 +WAATRGV +E +LENLPEDLQTDIRRHL K + V + Sbjct: 560 SWAATRGVNEEILLENLPEDLQTDIRRHLFKFVKKVRI 597 >AJC00855.1 cyclic nucleotide gated channel CNGC15 [Solanum lycopersicum] Length = 763 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSKRSQSVSL 177 NWAATRGV +E +LENLPEDLQ DIRRHL K + V + Sbjct: 557 NWAATRGVNEEMLLENLPEDLQRDIRRHLFKFIKKVRI 594 >XP_013452800.1 cyclic nucleotide gated channel protein [Medicago truncatula] KEH26828.1 cyclic nucleotide gated channel protein [Medicago truncatula] Length = 765 Score = 55.8 bits (133), Expect = 6e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 290 NWAATRGVTQETVLENLPEDLQTDIRRHLSK 198 +WAATRGV+++ VLENLPEDLQTDIRRHL K Sbjct: 534 SWAATRGVSEKMVLENLPEDLQTDIRRHLFK 564