BLASTX nr result
ID: Glycyrrhiza28_contig00010215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00010215 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EGN91295.1 hypothetical protein SERLA73DRAFT_80747 [Serpula lacr... 60 4e-09 EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela... 58 5e-09 KIM19405.1 hypothetical protein M408DRAFT_231258 [Serendipita ve... 54 2e-07 XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergil... 54 2e-07 XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [... 52 3e-07 XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 55 5e-07 XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [P... 50 5e-06 >EGN91295.1 hypothetical protein SERLA73DRAFT_80747 [Serpula lacrymans var. lacrymans S7.3] Length = 159 Score = 59.7 bits (143), Expect = 4e-09 Identities = 34/56 (60%), Positives = 39/56 (69%), Gaps = 2/56 (3%) Frame = -2 Query: 273 ILSSDVGE-PRP*R-RAAFLGLDRRMRREAITHPGGCHIPPFLIRRSKPMLTRPKG 112 ILS DV P+P R A FL +RR+R +AITHP GCHIP L+RRSK MLTR G Sbjct: 89 ILSMDVSRSPKPTRGHAEFLNPNRRIRSKAITHPEGCHIPSTLLRRSKLMLTRQPG 144 >EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia subvermispora B] Length = 87 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -1 Query: 283 LCQHPKLGRGRTPAIKASCVPRSRPTYATGGYNTP 179 L QHPK RGRTP IKA C PRS+P+YAT GYNTP Sbjct: 17 LRQHPKHERGRTPTIKACCEPRSQPSYATEGYNTP 51 >KIM19405.1 hypothetical protein M408DRAFT_231258 [Serendipita vermifera MAFF 305830] Length = 78 Score = 53.5 bits (127), Expect = 2e-07 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +1 Query: 124 GQHRF*PADKEGRNVAPSGVCYSLPSHTSVETEERSSPLWPGFA 255 GQH+F P +K+ NVA G CYSL + V TEERS+P WPG A Sbjct: 2 GQHQFRPREKDTWNVAVFGQCYSLVLYVLVGTEERSAPFWPGVA 45 >XP_020050895.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] XP_020050892.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94552.1 hypothetical protein ASPACDRAFT_37813 [Aspergillus aculeatus ATCC 16872] OJJ94555.1 hypothetical protein ASPACDRAFT_1877672 [Aspergillus aculeatus ATCC 16872] Length = 118 Score = 54.3 bits (129), Expect = 2e-07 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = -1 Query: 145 PVKTDVDPTEGSRPAE-PAEPNGHD*LQSFPFQQFHILFNSLSKVLFIF 2 P K + GS PA PAEP G Q+ PFQQFH+LFNSL KVLFIF Sbjct: 53 PPKLTLARPRGSTPARVPAEPRGRVWSQALPFQQFHVLFNSLFKVLFIF 101 >XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] XP_006458829.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] XP_007335029.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKM74328.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKV41603.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] EKV44288.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] Length = 51 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -2 Query: 75 TDFNRFPFNNFTYCLTLFPKCFSSF 1 TDF RFPF+NFTYCLTLFPK FSSF Sbjct: 4 TDFKRFPFSNFTYCLTLFPKFFSSF 28 >XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] EME80501.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 54.7 bits (130), Expect = 5e-07 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -2 Query: 153 LIRRSKPMLTRPKGVDR-QNRLNPTVTTDFNRFPFNNFTYCLTLFPKCFSSF 1 LI+RS+ M+ + V+R ++R N + RFPFNNFT LTLFPKCFSSF Sbjct: 49 LIQRSQTMMASRRRVNRSEDRPNTAAKSGCGRFPFNNFTCFLTLFPKCFSSF 100 >XP_007389360.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] EIN03413.1 hypothetical protein PUNSTDRAFT_78207, partial [Punctularia strigosozonata HHB-11173 SS5] Length = 90 Score = 50.1 bits (118), Expect = 5e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 60 FPFNNFTYCLTLFPKCFSSF 1 FPFNNFTYCLTLFPKCFSSF Sbjct: 1 FPFNNFTYCLTLFPKCFSSF 20