BLASTX nr result
ID: Glycyrrhiza28_contig00010120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00010120 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003550344.1 PREDICTED: probable carboxylesterase 13 [Glycine ... 54 1e-06 KHN12768.1 Putative carboxylesterase 13 [Glycine soja] 54 1e-06 XP_019457465.1 PREDICTED: probable carboxylesterase 2 [Lupinus a... 52 5e-06 >XP_003550344.1 PREDICTED: probable carboxylesterase 13 [Glycine max] KRH05704.1 hypothetical protein GLYMA_17G243700 [Glycine max] Length = 337 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 94 EDSTNNTNPHPHDEHVSHEFPGLIRVFTNGRVERLTGTDVV 216 ++ TN T + ++H+FPGLIRVFT+GRV+R TGTDVV Sbjct: 2 DNDTNTTPTTTSEPQIAHDFPGLIRVFTDGRVQRFTGTDVV 42 >KHN12768.1 Putative carboxylesterase 13 [Glycine soja] Length = 339 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 94 EDSTNNTNPHPHDEHVSHEFPGLIRVFTNGRVERLTGTDVV 216 ++ TN T + ++H+FPGLIRVFT+GRV+R TGTDVV Sbjct: 2 DNDTNTTPTTTSEPQIAHDFPGLIRVFTDGRVQRFTGTDVV 42 >XP_019457465.1 PREDICTED: probable carboxylesterase 2 [Lupinus angustifolius] OIW03435.1 hypothetical protein TanjilG_14660 [Lupinus angustifolius] Length = 333 Score = 52.0 bits (123), Expect = 5e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +1 Query: 88 MEEDSTNNTNPHPHDEHVSHEFPGLIRVFTNGRVERLTGTDVV 216 M+ ++N+TN EHV H+FPG+IRVF+NG VER GTD V Sbjct: 1 MDNSNSNSTNTD-QSEHVIHDFPGIIRVFSNGSVERFKGTDFV 42