BLASTX nr result
ID: Glycyrrhiza28_contig00010098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00010098 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN20036.1 GATA transcription factor 7 [Glycine soja] 53 2e-06 XP_003527135.1 PREDICTED: GATA transcription factor 7-like [Glyc... 53 2e-06 XP_014502491.1 PREDICTED: GATA transcription factor 7-like [Vign... 53 2e-06 XP_017419889.1 PREDICTED: GATA transcription factor 7-like [Vign... 52 3e-06 KYP64925.1 GATA transcription factor 12 [Cajanus cajan] 52 5e-06 XP_003522860.1 PREDICTED: GATA transcription factor 7-like [Glyc... 52 5e-06 XP_007135927.1 hypothetical protein PHAVU_009G003800g [Phaseolus... 51 7e-06 >KHN20036.1 GATA transcription factor 7 [Glycine soja] Length = 281 Score = 52.8 bits (125), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 165 ESRRRSFIVSFNSKIQIEVSNL*FYFCTQAGELAELEWVSHFVDDSLPEFSLLYP 1 +S S VS++S E++ AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 82 DSNSNSTGVSYDSLFSTELA-------VPAGDLEDLEWVSHFVDDSLPELSLLYP 129 >XP_003527135.1 PREDICTED: GATA transcription factor 7-like [Glycine max] KRH51471.1 hypothetical protein GLYMA_06G008800 [Glycine max] Length = 294 Score = 52.8 bits (125), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 165 ESRRRSFIVSFNSKIQIEVSNL*FYFCTQAGELAELEWVSHFVDDSLPEFSLLYP 1 +S S VS++S E++ AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 82 DSNSNSTGVSYDSLFSTELA-------VPAGDLEDLEWVSHFVDDSLPELSLLYP 129 >XP_014502491.1 PREDICTED: GATA transcription factor 7-like [Vigna radiata var. radiata] XP_014502492.1 PREDICTED: GATA transcription factor 7-like [Vigna radiata var. radiata] Length = 299 Score = 52.8 bits (125), Expect = 2e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 165 ESRRRSFIVSFNSKIQIEVSNL*FYFCTQAGELAELEWVSHFVDDSLPEFSLLYP 1 +S S VS++S E++ AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 81 DSNSNSTGVSYDSLFSAELA-------VPAGDLEDLEWVSHFVDDSLPELSLLYP 128 >XP_017419889.1 PREDICTED: GATA transcription factor 7-like [Vigna angularis] XP_017419890.1 PREDICTED: GATA transcription factor 7-like [Vigna angularis] KOM42302.1 hypothetical protein LR48_Vigan04g250000 [Vigna angularis] BAT77524.1 hypothetical protein VIGAN_02010900 [Vigna angularis var. angularis] Length = 299 Score = 52.4 bits (124), Expect = 3e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 165 ESRRRSFIVSFNSKIQIEVSNL*FYFCTQAGELAELEWVSHFVDDSLPEFSLLYP 1 +S S VS++S E++ AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 81 DSNSNSTGVSYDSIFSAELA-------VPAGDLEDLEWVSHFVDDSLPELSLLYP 128 >KYP64925.1 GATA transcription factor 12 [Cajanus cajan] Length = 297 Score = 51.6 bits (122), Expect = 5e-06 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 4/64 (6%) Frame = -3 Query: 180 VSCSGESRRRSFIVSFNSKIQIEVSNL*FYFCTQ----AGELAELEWVSHFVDDSLPEFS 13 VS S +S+ R S ++ + + +F T+ AG+L +LEWVSHFVDDSLPE S Sbjct: 64 VSVSSQSQDRGEDDSNSNSTGVSCDS---FFSTELAVPAGDLEDLEWVSHFVDDSLPELS 120 Query: 12 LLYP 1 LLYP Sbjct: 121 LLYP 124 >XP_003522860.1 PREDICTED: GATA transcription factor 7-like [Glycine max] KRH60781.1 hypothetical protein GLYMA_04G008900 [Glycine max] KRH60782.1 hypothetical protein GLYMA_04G008900 [Glycine max] Length = 305 Score = 51.6 bits (122), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 141 VSFNSKIQIEVSNL*FYFCTQAGELAELEWVSHFVDDSLPEFSLLYP 1 VS++S E++ AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 87 VSYDSLFSTELA-------VPAGDLEDLEWVSHFVDDSLPELSLLYP 126 >XP_007135927.1 hypothetical protein PHAVU_009G003800g [Phaseolus vulgaris] ESW07921.1 hypothetical protein PHAVU_009G003800g [Phaseolus vulgaris] Length = 300 Score = 51.2 bits (121), Expect = 7e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 78 AGELAELEWVSHFVDDSLPEFSLLYP 1 AG+L +LEWVSHFVDDSLPE SLLYP Sbjct: 103 AGDLEDLEWVSHFVDDSLPELSLLYP 128