BLASTX nr result
ID: Glycyrrhiza28_contig00010063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00010063 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB09784.1 hypothetical protein B456_001G165700 [Gossypium raimo... 87 1e-19 KUM48025.1 hypothetical protein ABT39_MTgene5020 (mitochondrion)... 68 4e-13 >KJB09784.1 hypothetical protein B456_001G165700 [Gossypium raimondii] Length = 134 Score = 87.0 bits (214), Expect = 1e-19 Identities = 49/76 (64%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = -3 Query: 224 RSEGVTCLILRCTHSRYENEMTPQLDSRPRLLP--YNSHQ*RH*AAGD*LKRQPPLPPCR 51 R EGVTCL+LRCTHSRYENEMTPQLDSRPRLL NS RH Sbjct: 64 RGEGVTCLVLRCTHSRYENEMTPQLDSRPRLLTTRTNSGAERH----------------- 106 Query: 50 LPTRARSSIGG*ECGP 3 LPTRARSSIGG ECGP Sbjct: 107 LPTRARSSIGGQECGP 122 >KUM48025.1 hypothetical protein ABT39_MTgene5020 (mitochondrion) [Picea glauca] Length = 50 Score = 68.2 bits (165), Expect = 4e-13 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 224 RSEGVTCLILRCTHSRYENEMTPQLDSRPRLL 129 R EGVTCL+LRCTHSRYENEMTPQLDSRPRLL Sbjct: 5 RGEGVTCLVLRCTHSRYENEMTPQLDSRPRLL 36