BLASTX nr result
ID: Glycyrrhiza28_contig00009915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00009915 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013462371.1 hypothetical protein MTR_2g005245 [Medicago trunc... 64 1e-11 >XP_013462371.1 hypothetical protein MTR_2g005245 [Medicago truncatula] ABE91858.1 hypothetical protein MtrDRAFT_AC140551g11v2 [Medicago truncatula] KEH36406.1 hypothetical protein MTR_2g005245 [Medicago truncatula] Length = 68 Score = 63.5 bits (153), Expect = 1e-11 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = +1 Query: 76 MRSITSRKLQRNQKSNAYIVRYLTKYISSCSRPIQQN*TSKGRKTLGENRAIEEIEKPQ 252 MR ITSRKLQ+NQKS A IVRYL K P + +KG +TLG+NR IE+IEKPQ Sbjct: 1 MRFITSRKLQQNQKSTANIVRYLGKDFLHARSPFKTE-QAKGHETLGKNRTIEDIEKPQ 58