BLASTX nr result
ID: Glycyrrhiza28_contig00009746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00009746 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP43922.1 hypothetical protein KK1_034604 [Cajanus cajan] 132 2e-34 XP_014491926.1 PREDICTED: interactor of constitutive active ROPs... 128 6e-33 XP_006594118.1 PREDICTED: interactor of constitutive active ROPs... 128 6e-33 XP_003542499.1 PREDICTED: interactor of constitutive active ROPs... 128 6e-33 KHN48324.1 Interactor of constitutive active ROPs 2, chloroplast... 128 6e-33 GAU26745.1 hypothetical protein TSUD_317430 [Trifolium subterran... 127 1e-32 XP_017405929.1 PREDICTED: interactor of constitutive active ROPs... 127 2e-32 XP_007144532.1 hypothetical protein PHAVU_007G163800g [Phaseolus... 126 3e-32 XP_016184886.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 XP_015937995.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 XP_016184883.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 XP_015937991.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 XP_006588764.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 KHN39107.1 Interactor of constitutive active ROPs 2, chloroplast... 124 2e-31 XP_006588759.1 PREDICTED: interactor of constitutive active ROPs... 124 2e-31 XP_019428539.1 PREDICTED: interactor of constitutive active ROPs... 120 5e-30 XP_019428537.1 PREDICTED: interactor of constitutive active ROPs... 120 5e-30 XP_019433286.1 PREDICTED: interactor of constitutive active ROPs... 119 6e-30 XP_015578503.1 PREDICTED: interactor of constitutive active ROPs... 119 7e-30 XP_015578502.1 PREDICTED: interactor of constitutive active ROPs... 119 1e-29 >KYP43922.1 hypothetical protein KK1_034604 [Cajanus cajan] Length = 579 Score = 132 bits (332), Expect = 2e-34 Identities = 67/80 (83%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLDNSYNSI A KMSSPYSEDTD+DS Sbjct: 501 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDNSYNSITA-KMSSPYSEDTDDDS 559 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 560 PKKKNTNMLKKIGVLWKKNH 579 >XP_014491926.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna radiata var. radiata] XP_014491927.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna radiata var. radiata] XP_014491928.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna radiata var. radiata] Length = 622 Score = 128 bits (322), Expect = 6e-33 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLD+SYN+I A KMSSPYSEDTD+DS Sbjct: 544 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISA-KMSSPYSEDTDDDS 602 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 603 PKKKNTNMLKKIGVLWKKNH 622 >XP_006594118.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] XP_006594119.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] KRH19815.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19816.1 hypothetical protein GLYMA_13G137200 [Glycine max] Length = 623 Score = 128 bits (322), Expect = 6e-33 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLD+SYNSI A KMSSPYSE+TD+DS Sbjct: 545 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITA-KMSSPYSENTDDDS 603 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 604 PKKKNTNMLKKIGVLWKKNH 623 >XP_003542499.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594115.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594116.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594117.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] KRH19817.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19818.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19819.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19820.1 hypothetical protein GLYMA_13G137200 [Glycine max] Length = 624 Score = 128 bits (322), Expect = 6e-33 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLD+SYNSI A KMSSPYSE+TD+DS Sbjct: 546 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITA-KMSSPYSENTDDDS 604 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 605 PKKKNTNMLKKIGVLWKKNH 624 >KHN48324.1 Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 625 Score = 128 bits (322), Expect = 6e-33 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLD+SYNSI A KMSSPYSE+TD+DS Sbjct: 547 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITA-KMSSPYSENTDDDS 605 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 606 PKKKNTNMLKKIGVLWKKNH 625 >GAU26745.1 hypothetical protein TSUD_317430 [Trifolium subterraneum] Length = 584 Score = 127 bits (319), Expect = 1e-32 Identities = 65/81 (80%), Positives = 68/81 (83%), Gaps = 1/81 (1%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYN-SIVAGKMSSPYSEDTDED 71 RRLKVQSDQWRK AMISSGNNGK ERTG LD+ YN SIV KMSSPYSEDTD+D Sbjct: 503 RRLKVQSDQWRKAAEAAAAMISSGNNGKIVERTGLLDSGYNNSIVGNKMSSPYSEDTDDD 562 Query: 70 SPKKKNTTMLKKIGVLWKKNN 8 SPKKKNTTMLKKIGVLWKKN+ Sbjct: 563 SPKKKNTTMLKKIGVLWKKNH 583 >XP_017405929.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] XP_017405930.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] XP_017405932.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] XP_017405933.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] KOM25842.1 hypothetical protein LR48_Vigan197s001100 [Vigna angularis] BAT95895.1 hypothetical protein VIGAN_08272500 [Vigna angularis var. angularis] Length = 622 Score = 127 bits (318), Expect = 2e-32 Identities = 64/80 (80%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQS+QWRK AMIS+GNNGKF ERTGSLD+SYN+I A KMSSPYSEDTD+DS Sbjct: 544 RRLKVQSEQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISA-KMSSPYSEDTDDDS 602 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 603 PKKKNTNMLKKIGVLWKKNH 622 >XP_007144532.1 hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] ESW16526.1 hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] Length = 609 Score = 126 bits (317), Expect = 3e-32 Identities = 64/80 (80%), Positives = 70/80 (87%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AMIS+GNNGKF ERTGSLD++YNSI A KMSSP+SEDTD+DS Sbjct: 531 RRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSNYNSIGA-KMSSPFSEDTDDDS 589 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 590 PKKKNTNMLKKIGVLWKKNH 609 >XP_016184886.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 611 Score = 124 bits (311), Expect = 2e-31 Identities = 60/80 (75%), Positives = 68/80 (85%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK ++S+GNNGK ERTGSLDN++NSI GKM+SPYSEDTD+DS Sbjct: 533 RRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSIT-GKMTSPYSEDTDDDS 591 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 592 PKKKNTNMLKKIGVLWKKNH 611 >XP_015937995.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Arachis duranensis] Length = 611 Score = 124 bits (311), Expect = 2e-31 Identities = 60/80 (75%), Positives = 68/80 (85%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK ++S+GNNGK ERTGSLDN++NSI GKM+SPYSEDTD+DS Sbjct: 533 RRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSIT-GKMTSPYSEDTDDDS 591 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 592 PKKKNTNMLKKIGVLWKKNH 611 >XP_016184883.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184884.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184885.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 623 Score = 124 bits (311), Expect = 2e-31 Identities = 60/80 (75%), Positives = 68/80 (85%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK ++S+GNNGK ERTGSLDN++NSI GKM+SPYSEDTD+DS Sbjct: 545 RRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSIT-GKMTSPYSEDTDDDS 603 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 604 PKKKNTNMLKKIGVLWKKNH 623 >XP_015937991.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis duranensis] XP_015937992.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis duranensis] XP_015937993.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis duranensis] XP_015937994.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Arachis duranensis] Length = 623 Score = 124 bits (311), Expect = 2e-31 Identities = 60/80 (75%), Positives = 68/80 (85%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK ++S+GNNGK ERTGSLDN++NSI GKM+SPYSEDTD+DS Sbjct: 545 RRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSIT-GKMTSPYSEDTDDDS 603 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 604 PKKKNTNMLKKIGVLWKKNH 623 >XP_006588764.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] KRH32408.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32409.1 hypothetical protein GLYMA_10G049600 [Glycine max] Length = 625 Score = 124 bits (311), Expect = 2e-31 Identities = 65/81 (80%), Positives = 69/81 (85%), Gaps = 1/81 (1%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDT-DED 71 RRLKVQSDQWRK AMISSGNNGKF ERTGSLD+SYNS+ A KMSSPYSEDT D+D Sbjct: 546 RRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTA-KMSSPYSEDTDDDD 604 Query: 70 SPKKKNTTMLKKIGVLWKKNN 8 SPKKKNT MLKKIGVLWKK + Sbjct: 605 SPKKKNTNMLKKIGVLWKKTH 625 >KHN39107.1 Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 626 Score = 124 bits (311), Expect = 2e-31 Identities = 65/81 (80%), Positives = 69/81 (85%), Gaps = 1/81 (1%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDT-DED 71 RRLKVQSDQWRK AMISSGNNGKF ERTGSLD+SYNS+ A KMSSPYSEDT D+D Sbjct: 547 RRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTA-KMSSPYSEDTDDDD 605 Query: 70 SPKKKNTTMLKKIGVLWKKNN 8 SPKKKNT MLKKIGVLWKK + Sbjct: 606 SPKKKNTNMLKKIGVLWKKTH 626 >XP_006588759.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588760.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588761.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588762.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588763.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618467.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618468.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618469.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618470.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] KRH32410.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32411.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32412.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32413.1 hypothetical protein GLYMA_10G049600 [Glycine max] Length = 626 Score = 124 bits (311), Expect = 2e-31 Identities = 65/81 (80%), Positives = 69/81 (85%), Gaps = 1/81 (1%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDT-DED 71 RRLKVQSDQWRK AMISSGNNGKF ERTGSLD+SYNS+ A KMSSPYSEDT D+D Sbjct: 547 RRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTA-KMSSPYSEDTDDDD 605 Query: 70 SPKKKNTTMLKKIGVLWKKNN 8 SPKKKNT MLKKIGVLWKK + Sbjct: 606 SPKKKNTNMLKKIGVLWKKTH 626 >XP_019428539.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 624 Score = 120 bits (301), Expect = 5e-30 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 3/83 (3%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSI---VAGKMSSPYSEDTD 77 RRLKVQSDQWRK AM+S+GNNGK ERTGSLD+SYNS + GKMSSPYSEDTD Sbjct: 542 RRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSEDTD 601 Query: 76 EDSPKKKNTTMLKKIGVLWKKNN 8 ++SPKKKN+ MLKKIGVLWKK++ Sbjct: 602 DESPKKKNSNMLKKIGVLWKKSH 624 >XP_019428537.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] XP_019428538.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] OIV90488.1 hypothetical protein TanjilG_18672 [Lupinus angustifolius] Length = 625 Score = 120 bits (301), Expect = 5e-30 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 3/83 (3%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSI---VAGKMSSPYSEDTD 77 RRLKVQSDQWRK AM+S+GNNGK ERTGSLD+SYNS + GKMSSPYSEDTD Sbjct: 543 RRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSEDTD 602 Query: 76 EDSPKKKNTTMLKKIGVLWKKNN 8 ++SPKKKN+ MLKKIGVLWKK++ Sbjct: 603 DESPKKKNSNMLKKIGVLWKKSH 625 >XP_019433286.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 448 Score = 119 bits (297), Expect = 6e-30 Identities = 58/80 (72%), Positives = 66/80 (82%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK +M+S GNNGKF ER G LD+S+NS V GK++SPYSED D+DS Sbjct: 369 RRLKVQSDQWRKAAEAAASMLSPGNNGKFVERNGLLDSSFNS-VTGKVNSPYSEDMDDDS 427 Query: 67 PKKKNTTMLKKIGVLWKKNN 8 PKKKNT MLKKIGVLWKKN+ Sbjct: 428 PKKKNTNMLKKIGVLWKKNH 447 >XP_015578503.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X4 [Ricinus communis] Length = 504 Score = 119 bits (298), Expect = 7e-30 Identities = 60/78 (76%), Positives = 65/78 (83%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AM+SSGNNGKF ERTGSL+NSYN+I AG M SPYSED ++DS Sbjct: 425 RRLKVQSDQWRKAAEAAAAMLSSGNNGKFVERTGSLENSYNTI-AGAMGSPYSEDMEDDS 483 Query: 67 PKKKNTTMLKKIGVLWKK 14 PKKKN MLKKIGVLWKK Sbjct: 484 PKKKNGNMLKKIGVLWKK 501 >XP_015578502.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X3 [Ricinus communis] Length = 622 Score = 119 bits (298), Expect = 1e-29 Identities = 60/78 (76%), Positives = 65/78 (83%) Frame = -1 Query: 247 RRLKVQSDQWRKXXXXXXAMISSGNNGKFAERTGSLDNSYNSIVAGKMSSPYSEDTDEDS 68 RRLKVQSDQWRK AM+SSGNNGKF ERTGSL+NSYN+I AG M SPYSED ++DS Sbjct: 543 RRLKVQSDQWRKAAEAAAAMLSSGNNGKFVERTGSLENSYNTI-AGAMGSPYSEDMEDDS 601 Query: 67 PKKKNTTMLKKIGVLWKK 14 PKKKN MLKKIGVLWKK Sbjct: 602 PKKKNGNMLKKIGVLWKK 619