BLASTX nr result
ID: Glycyrrhiza28_contig00009544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00009544 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017437085.1 PREDICTED: U-box domain-containing protein 4-like... 85 3e-17 XP_017437084.1 PREDICTED: U-box domain-containing protein 4-like... 85 3e-17 KYP62669.1 U-box domain-containing protein 2 [Cajanus cajan] 82 5e-17 XP_007147642.1 hypothetical protein PHAVU_006G142100g [Phaseolus... 84 1e-16 XP_003534872.1 PREDICTED: U-box domain-containing protein 4 [Gly... 83 2e-16 XP_014518934.1 PREDICTED: U-box domain-containing protein 4-like... 82 3e-16 KHN32958.1 U-box domain-containing protein 4 [Glycine soja] 82 3e-16 XP_003546191.1 PREDICTED: U-box domain-containing protein 4-like... 82 4e-16 XP_004486322.1 PREDICTED: U-box domain-containing protein 4 [Cic... 75 9e-14 XP_019419015.1 PREDICTED: U-box domain-containing protein 4-like... 69 2e-11 XP_019419014.1 PREDICTED: U-box domain-containing protein 4-like... 69 2e-11 XP_003594249.1 armadillo/beta-catenin-like repeat protein [Medic... 67 1e-10 XP_015958996.1 PREDICTED: LOW QUALITY PROTEIN: U-box domain-cont... 63 2e-09 XP_016197552.1 PREDICTED: U-box domain-containing protein 4 [Ara... 63 2e-09 GAU48911.1 hypothetical protein TSUD_406630 [Trifolium subterran... 62 4e-09 XP_008440076.1 PREDICTED: U-box domain-containing protein 4 [Cuc... 62 5e-09 XP_004134799.1 PREDICTED: U-box domain-containing protein 4 [Cuc... 62 5e-09 XP_010094691.1 U-box domain-containing protein 4 [Morus notabili... 62 7e-09 XP_019424683.1 PREDICTED: U-box domain-containing protein 2-like... 61 9e-09 XP_002528228.1 PREDICTED: U-box domain-containing protein 4 [Ric... 60 2e-08 >XP_017437085.1 PREDICTED: U-box domain-containing protein 4-like isoform X2 [Vigna angularis] Length = 438 Score = 85.1 bits (209), Expect = 3e-17 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQRHIGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYQYH-SSVSSKTQRHIGRSMRTIRSNFFQ 47 >XP_017437084.1 PREDICTED: U-box domain-containing protein 4-like isoform X1 [Vigna angularis] KOM53326.1 hypothetical protein LR48_Vigan09g198500 [Vigna angularis] BAT87542.1 hypothetical protein VIGAN_05092400 [Vigna angularis var. angularis] Length = 457 Score = 85.1 bits (209), Expect = 3e-17 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQRHIGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYQYH-SSVSSKTQRHIGRSMRTIRSNFFQ 47 >KYP62669.1 U-box domain-containing protein 2 [Cajanus cajan] Length = 222 Score = 82.0 bits (201), Expect = 5e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL R+Y YH SSVS+K+QRHIGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLPRAYQYH-SSVSSKSQRHIGRSMRTIRSNFFQ 47 >XP_007147642.1 hypothetical protein PHAVU_006G142100g [Phaseolus vulgaris] ESW19636.1 hypothetical protein PHAVU_006G142100g [Phaseolus vulgaris] Length = 457 Score = 83.6 bits (205), Expect = 1e-16 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL R+Y YH SSVS+KTQRHIGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLPRNYQYH-SSVSSKTQRHIGRSMRTIRSNFFQ 47 >XP_003534872.1 PREDICTED: U-box domain-containing protein 4 [Glycine max] KRH36562.1 hypothetical protein GLYMA_09G011300 [Glycine max] Length = 458 Score = 83.2 bits (204), Expect = 2e-16 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQRHIGRSMRTIRS+FFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYQYH-SSVSSKTQRHIGRSMRTIRSSFFQ 47 >XP_014518934.1 PREDICTED: U-box domain-containing protein 4-like [Vigna radiata var. radiata] Length = 457 Score = 82.4 bits (202), Expect = 3e-16 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQRH GRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYLYH-SSVSSKTQRHTGRSMRTIRSNFFQ 47 >KHN32958.1 U-box domain-containing protein 4 [Glycine soja] Length = 381 Score = 82.0 bits (201), Expect = 3e-16 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQR IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYQYH-SSVSSKTQRQIGRSMRTIRSNFFQ 47 >XP_003546191.1 PREDICTED: U-box domain-containing protein 4-like [Glycine max] KRH11541.1 hypothetical protein GLYMA_15G115800 [Glycine max] Length = 457 Score = 82.0 bits (201), Expect = 4e-16 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNSSRFPL RSY YH SSVS+KTQR IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSSRFPLARSYQYH-SSVSSKTQRQIGRSMRTIRSNFFQ 47 >XP_004486322.1 PREDICTED: U-box domain-containing protein 4 [Cicer arietinum] Length = 457 Score = 75.5 bits (184), Expect = 9e-14 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRS+S+RFPL+RSY YH SSVS+KTQR+IGRSMRTIRS+ FQ Sbjct: 1 MVSLEESRSDSNRFPLSRSYQYH-SSVSSKTQRNIGRSMRTIRSSIFQ 47 >XP_019419015.1 PREDICTED: U-box domain-containing protein 4-like isoform X2 [Lupinus angustifolius] Length = 440 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNS+RF L RSY +H S+KT R IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSTRFSLNRSYQFH----SSKTHRQIGRSMRTIRSNFFQ 44 >XP_019419014.1 PREDICTED: U-box domain-containing protein 4-like isoform X1 [Lupinus angustifolius] OIV96065.1 hypothetical protein TanjilG_27169 [Lupinus angustifolius] Length = 458 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEESRSNS+RF L RSY +H S+KT R IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESRSNSTRFSLNRSYQFH----SSKTHRQIGRSMRTIRSNFFQ 44 >XP_003594249.1 armadillo/beta-catenin-like repeat protein [Medicago truncatula] AES64500.1 armadillo/beta-catenin-like repeat protein [Medicago truncatula] Length = 460 Score = 66.6 bits (161), Expect = 1e-10 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFF 314 MVSLE+SRSNS+RFPL ++Y YH SS+S+K+QR+IGRSMRT RS+ F Sbjct: 1 MVSLEDSRSNSNRFPLPKTYQYH-SSISSKSQRNIGRSMRTRRSSIF 46 >XP_015958996.1 PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 2 [Arachis duranensis] Length = 410 Score = 63.2 bits (152), Expect = 2e-09 Identities = 35/49 (71%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +3 Query: 174 MVSLEESRSNSS-RFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEES SN++ RFPL RSY + +S++S KT R IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESGSNNTNRFPLERSY-HSVSAISPKTHRRIGRSMRTIRSNFFQ 48 >XP_016197552.1 PREDICTED: U-box domain-containing protein 4 [Arachis ipaensis] Length = 464 Score = 63.2 bits (152), Expect = 2e-09 Identities = 35/49 (71%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +3 Query: 174 MVSLEESRSNSS-RFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLEES SN++ RFPL RSY + +S++S KT R IGRSMRTIRSNFFQ Sbjct: 1 MVSLEESGSNNTNRFPLERSY-HSVSAISPKTHRRIGRSMRTIRSNFFQ 48 >GAU48911.1 hypothetical protein TSUD_406630 [Trifolium subterraneum] Length = 456 Score = 62.4 bits (150), Expect = 4e-09 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFF 314 MVSLEESRSNS+RFPL R+Y YH S+K++R+IGRSMRT RS+ F Sbjct: 1 MVSLEESRSNSNRFPLPRTYQYH----SSKSERNIGRSMRTRRSSIF 43 >XP_008440076.1 PREDICTED: U-box domain-containing protein 4 [Cucumis melo] Length = 459 Score = 62.0 bits (149), Expect = 5e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLE+S S S+RFPLTR+ S+ S+K R+IGRSMRTIRSNFFQ Sbjct: 1 MVSLEDSHSTSNRFPLTRNCYSPSSTTSSKISRNIGRSMRTIRSNFFQ 48 >XP_004134799.1 PREDICTED: U-box domain-containing protein 4 [Cucumis sativus] KGN49052.1 hypothetical protein Csa_6G511670 [Cucumis sativus] Length = 459 Score = 62.0 bits (149), Expect = 5e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLE+S S S+RFPLTR+ S+ S+K R+IGRSMRTIRSNFFQ Sbjct: 1 MVSLEDSHSTSNRFPLTRNCYSPSSTTSSKISRNIGRSMRTIRSNFFQ 48 >XP_010094691.1 U-box domain-containing protein 4 [Morus notabilis] EXB56663.1 U-box domain-containing protein 4 [Morus notabilis] Length = 455 Score = 61.6 bits (148), Expect = 7e-09 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVSLE+S S S+RFPLTR+Y Y ++ ++ RH GRSMRTIRSNFFQ Sbjct: 1 MVSLEDSHSGSTRFPLTRNY-YTAANSPSRISRHTGRSMRTIRSNFFQ 47 >XP_019424683.1 PREDICTED: U-box domain-containing protein 2-like [Lupinus angustifolius] OIV91848.1 hypothetical protein TanjilG_17840 [Lupinus angustifolius] Length = 458 Score = 61.2 bits (147), Expect = 9e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYPYHLSSVSAKTQRHIGRSMRTIRSNFFQ 317 MVS+EESRSNS+RF L R++ +H S+KT R IGRSMRTIRSNF Q Sbjct: 1 MVSIEESRSNSTRFSLNRNHQFH----SSKTHRFIGRSMRTIRSNFSQ 44 >XP_002528228.1 PREDICTED: U-box domain-containing protein 4 [Ricinus communis] EEF34143.1 ubiquitin-protein ligase, putative [Ricinus communis] Length = 467 Score = 60.5 bits (145), Expect = 2e-08 Identities = 33/51 (64%), Positives = 41/51 (80%), Gaps = 3/51 (5%) Frame = +3 Query: 174 MVSLEESRSNSSRFPLTRSYP--YHLSSVS-AKTQRHIGRSMRTIRSNFFQ 317 MVSLE+S SN++RFPLTR+ Y+ SSVS + RH+GRSMRTIRSNF+Q Sbjct: 1 MVSLEDSHSNANRFPLTRTNNNFYNPSSVSNTRINRHVGRSMRTIRSNFYQ 51