BLASTX nr result
ID: Glycyrrhiza28_contig00009184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00009184 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003549331.2 PREDICTED: pentatricopeptide repeat-containing pr... 73 4e-13 KHN03541.1 Pentatricopeptide repeat-containing protein, chloropl... 70 4e-12 KHN42271.1 Pentatricopeptide repeat-containing protein, chloropl... 64 4e-10 XP_006584099.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 4e-10 XP_007154040.1 hypothetical protein PHAVU_003G086100g [Phaseolus... 64 4e-10 XP_016195774.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 6e-10 XP_015940563.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 3e-09 XP_014509541.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 2e-08 XP_017412120.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-08 XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-07 XP_003610579.1 pentatricopeptide (PPR) repeat protein [Medicago ... 55 8e-07 >XP_003549331.2 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] KRH01964.1 hypothetical protein GLYMA_17G006500 [Glycine max] Length = 712 Score = 72.8 bits (177), Expect = 4e-13 Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = +3 Query: 90 GGEMAYRLCSTPSALLHDLPSISSSS---RKFKVRNFIPSFQPPSPLTPHSKTFLHAN 254 G +MAY LCS+PS+L HDLPSISSSS RKFK+RN FQP TPHSKT LH + Sbjct: 21 GAKMAYNLCSSPSSLFHDLPSISSSSSSCRKFKLRNSSSFFQPSPSPTPHSKTLLHVS 78 >KHN03541.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 689 Score = 70.1 bits (170), Expect = 4e-12 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSISSSS---RKFKVRNFIPSFQPPSPLTPHSKTFLHAN 254 MAY LCS+PS+L HDLPSISSSS RKFK+RN FQP TPHSKT LH + Sbjct: 1 MAYNLCSSPSSLFHDLPSISSSSSSCRKFKLRNSSSFFQPSPSPTPHSKTLLHVS 55 >KHN42271.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 685 Score = 64.3 bits (155), Expect = 4e-10 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSI--SSSSRKFKVRNFIPSFQPPSPLTPHSKTFLHAN 254 MAY LCS+PS+L HDLPSI SSSSRKFK+RN S LTPHSKT LH + Sbjct: 1 MAYNLCSSPSSLFHDLPSISSSSSSRKFKLRNL-----SSSSLTPHSKTLLHVS 49 >XP_006584099.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] KRH51188.1 hypothetical protein GLYMA_07G267500 [Glycine max] Length = 685 Score = 64.3 bits (155), Expect = 4e-10 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSI--SSSSRKFKVRNFIPSFQPPSPLTPHSKTFLHAN 254 MAY LCS+PS+L HDLPSI SSSSRKFK+RN S LTPHSKT LH + Sbjct: 1 MAYNLCSSPSSLFHDLPSISSSSSSRKFKLRNL-----SSSSLTPHSKTLLHVS 49 >XP_007154040.1 hypothetical protein PHAVU_003G086100g [Phaseolus vulgaris] ESW26034.1 hypothetical protein PHAVU_003G086100g [Phaseolus vulgaris] Length = 704 Score = 64.3 bits (155), Expect = 4e-10 Identities = 40/68 (58%), Positives = 43/68 (63%), Gaps = 12/68 (17%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSI---------SSSSRKFKVRNFIPSFQPPSP---LTPHSKTF 242 MAY LCS+PS+L HDLPSI SSSSRKFK+RN S PSP LT SKT Sbjct: 1 MAYNLCSSPSSLFHDLPSISSSPSSSSSSSSSRKFKLRNLSSSSFQPSPSHSLTLPSKTL 60 Query: 243 LHANHVSL 266 LHA VSL Sbjct: 61 LHAPQVSL 68 >XP_016195774.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Arachis ipaensis] Length = 705 Score = 63.9 bits (154), Expect = 6e-10 Identities = 42/63 (66%), Positives = 45/63 (71%), Gaps = 7/63 (11%) Frame = +3 Query: 99 MAYRLCSTPSALLHDL-PSISSSSRKFK----VRNFIPSFQPPS-PLTP-HSKTFLHANH 257 MAY +CS+PS LH L PSI SSS FK VRNF SFQPPS PLTP S+TFLHAN Sbjct: 1 MAYHVCSSPS--LHSLSPSIGSSSSSFKFNHKVRNFASSFQPPSTPLTPSQSRTFLHANC 58 Query: 258 VSL 266 VSL Sbjct: 59 VSL 61 >XP_015940563.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Arachis duranensis] Length = 705 Score = 62.0 bits (149), Expect = 3e-09 Identities = 41/63 (65%), Positives = 44/63 (69%), Gaps = 7/63 (11%) Frame = +3 Query: 99 MAYRLCSTPSALLHDL-PSISSSSRKFK----VRNFIPSFQPPS-PLTP-HSKTFLHANH 257 MAY +CS+PS LH L PSI SSS FK VRNF SFQPPS LTP S+TFLHAN Sbjct: 1 MAYHVCSSPS--LHSLSPSIGSSSSSFKFNHKVRNFASSFQPPSTSLTPSQSRTFLHANR 58 Query: 258 VSL 266 VSL Sbjct: 59 VSL 61 >XP_014509541.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Vigna radiata var. radiata] XP_014509542.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Vigna radiata var. radiata] XP_014509543.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Vigna radiata var. radiata] Length = 708 Score = 59.7 bits (143), Expect = 2e-08 Identities = 38/71 (53%), Positives = 42/71 (59%), Gaps = 15/71 (21%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSI------------SSSSRKFKVRNF-IPSFQP--PSPLTPHS 233 MAY +CS+PS+L HD PSI SSSSRKFK+RN SFQP T HS Sbjct: 1 MAYNICSSPSSLFHDFPSISSSSSPSSSSSSSSSSRKFKLRNLSSSSFQPFHSHSATLHS 60 Query: 234 KTFLHANHVSL 266 KT LHA VSL Sbjct: 61 KTLLHAPQVSL 71 >XP_017412120.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Vigna angularis] KOM33709.1 hypothetical protein LR48_Vigan01g326500 [Vigna angularis] BAT77306.1 hypothetical protein VIGAN_01540500 [Vigna angularis var. angularis] Length = 709 Score = 59.3 bits (142), Expect = 2e-08 Identities = 38/72 (52%), Positives = 42/72 (58%), Gaps = 16/72 (22%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSI-------------SSSSRKFKVRNF-IPSFQP--PSPLTPH 230 MAY +CS+PS+L HD PSI SSSSRKFK+RN SFQP T H Sbjct: 1 MAYNICSSPSSLFHDFPSISSSSSSPSSSSSSSSSSRKFKLRNLSSSSFQPSHSHSATLH 60 Query: 231 SKTFLHANHVSL 266 SKT LHA VSL Sbjct: 61 SKTLLHAPQVSL 72 >XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Cicer arietinum] Length = 688 Score = 57.0 bits (136), Expect = 2e-07 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +3 Query: 99 MAYRLCST-PSALLHDLPSISSSSRKFKVRNFIPSFQPPSPLTPHSKTFLHAN 254 MAY LCS+ PS+L HD PSISS KFKVRNF PSFQ TP SKT LH + Sbjct: 1 MAYHLCSSSPSSLFHDPPSISSL--KFKVRNFSPSFQ-----TPSSKTLLHVS 46 >XP_003610579.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES92776.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 706 Score = 55.1 bits (131), Expect = 8e-07 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 8/58 (13%) Frame = +3 Query: 99 MAYRLCSTPSALLHDLPSISSSSRKFKVRNFIPSFQPP--------SPLTPHSKTFLH 248 M+Y LCS+ S L HD ++ SSRKFK+RNF SF P S LTPHSKT LH Sbjct: 1 MSYHLCSSSSPLFHD--PLTISSRKFKLRNFPSSFHTPSSSSSSSSSSLTPHSKTLLH 56