BLASTX nr result
ID: Glycyrrhiza28_contig00009103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00009103 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004497724.1 PREDICTED: arginine/serine-rich coiled-coil prote... 92 4e-19 XP_004497723.1 PREDICTED: arginine/serine-rich coiled-coil prote... 92 4e-19 XP_004497722.1 PREDICTED: arginine/serine-rich coiled-coil prote... 92 4e-19 XP_004497720.1 PREDICTED: arginine/serine-rich coiled-coil prote... 92 4e-19 KRH71744.1 hypothetical protein GLYMA_02G166100 [Glycine max] 84 2e-16 XP_006575187.1 PREDICTED: arginine/serine-rich coiled-coil prote... 84 2e-16 XP_006575186.1 PREDICTED: arginine/serine-rich coiled-coil prote... 84 2e-16 XP_014623222.1 PREDICTED: arginine/serine-rich coiled-coil prote... 84 2e-16 XP_003519025.1 PREDICTED: arginine/serine-rich coiled-coil prote... 84 2e-16 XP_006575183.1 PREDICTED: arginine/serine-rich coiled-coil prote... 84 2e-16 KYP59855.1 hypothetical protein KK1_015296, partial [Cajanus cajan] 83 7e-16 XP_019427651.1 PREDICTED: splicing regulatory glutamine/lysine-r... 78 3e-14 OIV90025.1 hypothetical protein TanjilG_23945 [Lupinus angustifo... 78 3e-14 XP_019427650.1 PREDICTED: zinc finger CCCH domain-containing pro... 78 3e-14 XP_019427649.1 PREDICTED: splicing regulatory glutamine/lysine-r... 78 3e-14 XP_002266542.1 PREDICTED: arginine/serine-rich coiled-coil prote... 78 4e-14 XP_010653975.1 PREDICTED: arginine/serine-rich coiled-coil prote... 78 4e-14 XP_014514374.1 PREDICTED: arginine/serine-rich coiled-coil prote... 77 5e-14 XP_014514373.1 PREDICTED: arginine/serine-rich coiled-coil prote... 77 6e-14 XP_007145370.1 hypothetical protein PHAVU_007G233400g [Phaseolus... 77 7e-14 >XP_004497724.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X4 [Cicer arietinum] Length = 411 Score = 91.7 bits (226), Expect = 4e-19 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 M SNS SPP DNSD KNAFRKPSG+A NR YRRRSPIEGSSSPDGSPR EH Sbjct: 1 MGSNSQSPPHDNSDTKNAFRKPSGEATNRNYRRRSPIEGSSSPDGSPRCEH 51 >XP_004497723.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X3 [Cicer arietinum] Length = 412 Score = 91.7 bits (226), Expect = 4e-19 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 M SNS SPP DNSD KNAFRKPSG+A NR YRRRSPIEGSSSPDGSPR EH Sbjct: 1 MGSNSQSPPHDNSDTKNAFRKPSGEATNRNYRRRSPIEGSSSPDGSPRCEH 51 >XP_004497722.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X2 [Cicer arietinum] Length = 439 Score = 91.7 bits (226), Expect = 4e-19 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 M SNS SPP DNSD KNAFRKPSG+A NR YRRRSPIEGSSSPDGSPR EH Sbjct: 1 MGSNSQSPPHDNSDTKNAFRKPSGEATNRNYRRRSPIEGSSSPDGSPRCEH 51 >XP_004497720.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Cicer arietinum] XP_004497721.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Cicer arietinum] Length = 440 Score = 91.7 bits (226), Expect = 4e-19 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 M SNS SPP DNSD KNAFRKPSG+A NR YRRRSPIEGSSSPDGSPR EH Sbjct: 1 MGSNSQSPPHDNSDTKNAFRKPSGEATNRNYRRRSPIEGSSSPDGSPRCEH 51 >KRH71744.1 hypothetical protein GLYMA_02G166100 [Glycine max] Length = 420 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >XP_006575187.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X5 [Glycine max] Length = 438 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >XP_006575186.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X4 [Glycine max] Length = 440 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >XP_014623222.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X3 [Glycine max] Length = 449 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >XP_003519025.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X2 [Glycine max] KHN41334.1 hypothetical protein glysoja_047787 [Glycine soja] Length = 479 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >XP_006575183.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Glycine max] XP_006575184.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Glycine max] XP_006575185.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Glycine max] Length = 480 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/51 (78%), Positives = 41/51 (80%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSNS P NSD KNAFRKPSGDAANR YRRRSP+EGS SPD SPRH H Sbjct: 2 MDSNSPFLPHCNSDTKNAFRKPSGDAANRNYRRRSPVEGSPSPDASPRHGH 52 >KYP59855.1 hypothetical protein KK1_015296, partial [Cajanus cajan] Length = 478 Score = 82.8 bits (203), Expect = 7e-16 Identities = 41/54 (75%), Positives = 41/54 (75%) Frame = -2 Query: 163 LGRMDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 LG MDSN SP NSD KNAFRKPSGDAANR YRRRSPIEGS D SPRH H Sbjct: 1 LGMMDSNLPSPAHVNSDTKNAFRKPSGDAANRNYRRRSPIEGSPPSDVSPRHGH 54 >XP_019427651.1 PREDICTED: splicing regulatory glutamine/lysine-rich protein 1 isoform X3 [Lupinus angustifolius] Length = 443 Score = 78.2 bits (191), Expect = 3e-14 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSN SPP D+SDAKN FRKPS DA R YRRRSP S PDGSP+HEH Sbjct: 1 MDSNLPSPPHDDSDAKNVFRKPSADATGRNYRRRSPAGESPPPDGSPKHEH 51 >OIV90025.1 hypothetical protein TanjilG_23945 [Lupinus angustifolius] Length = 455 Score = 78.2 bits (191), Expect = 3e-14 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSN SPP D+SDAKN FRKPS DA R YRRRSP S PDGSP+HEH Sbjct: 1 MDSNLPSPPHDDSDAKNVFRKPSADATGRNYRRRSPAGESPPPDGSPKHEH 51 >XP_019427650.1 PREDICTED: zinc finger CCCH domain-containing protein 13 isoform X2 [Lupinus angustifolius] Length = 567 Score = 78.2 bits (191), Expect = 3e-14 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSN SPP D+SDAKN FRKPS DA R YRRRSP S PDGSP+HEH Sbjct: 1 MDSNLPSPPHDDSDAKNVFRKPSADATGRNYRRRSPAGESPPPDGSPKHEH 51 >XP_019427649.1 PREDICTED: splicing regulatory glutamine/lysine-rich protein 1 isoform X1 [Lupinus angustifolius] Length = 568 Score = 78.2 bits (191), Expect = 3e-14 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSN SPP D+SDAKN FRKPS DA R YRRRSP S PDGSP+HEH Sbjct: 1 MDSNLPSPPHDDSDAKNVFRKPSADATGRNYRRRSPAGESPPPDGSPKHEH 51 >XP_002266542.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X2 [Vitis vinifera] CBI30136.3 unnamed protein product, partial [Vitis vinifera] Length = 510 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDS+ SPP+D +DAK AFRKP+ DA NRKYRRRSP GSSS GSP HEH Sbjct: 1 MDSSLKSPPRDKADAKTAFRKPTNDATNRKYRRRSPTSGSSSSGGSPIHEH 51 >XP_010653975.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vitis vinifera] XP_010653976.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vitis vinifera] XP_019077371.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vitis vinifera] XP_019077372.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vitis vinifera] XP_019077373.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vitis vinifera] Length = 610 Score = 77.8 bits (190), Expect = 4e-14 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDS+ SPP+D +DAK AFRKP+ DA NRKYRRRSP GSSS GSP HEH Sbjct: 1 MDSSLKSPPRDKADAKTAFRKPTNDATNRKYRRRSPTSGSSSSGGSPIHEH 51 >XP_014514374.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X2 [Vigna radiata var. radiata] Length = 437 Score = 77.4 bits (189), Expect = 5e-14 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -2 Query: 151 DSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 DSNS P NSDAKNAFRKPSGDAA+R YRRRSP++GS SPD +PR H Sbjct: 3 DSNSPLLPHGNSDAKNAFRKPSGDAASRNYRRRSPVDGSPSPDANPRQGH 52 >XP_014514373.1 PREDICTED: arginine/serine-rich coiled-coil protein 2 isoform X1 [Vigna radiata var. radiata] Length = 479 Score = 77.4 bits (189), Expect = 6e-14 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -2 Query: 151 DSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 DSNS P NSDAKNAFRKPSGDAA+R YRRRSP++GS SPD +PR H Sbjct: 3 DSNSPLLPHGNSDAKNAFRKPSGDAASRNYRRRSPVDGSPSPDANPRQGH 52 >XP_007145370.1 hypothetical protein PHAVU_007G233400g [Phaseolus vulgaris] ESW17364.1 hypothetical protein PHAVU_007G233400g [Phaseolus vulgaris] Length = 468 Score = 77.0 bits (188), Expect = 7e-14 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 154 MDSNSLSPPQDNSDAKNAFRKPSGDAANRKYRRRSPIEGSSSPDGSPRHEH 2 MDSN PP +SD K AFRKPSGDAA+R YRRRSP++GSSSPD +PR H Sbjct: 2 MDSNLPLPPHGDSDTKTAFRKPSGDAASRNYRRRSPVDGSSSPDANPRQGH 52