BLASTX nr result
ID: Glycyrrhiza28_contig00008228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00008228 (568 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003552765.1 PREDICTED: pentatricopeptide repeat-containing pr... 206 7e-60 XP_017407754.1 PREDICTED: pentatricopeptide repeat-containing pr... 204 9e-59 XP_014521683.1 PREDICTED: pentatricopeptide repeat-containing pr... 203 2e-58 XP_007163838.1 hypothetical protein PHAVU_001G268500g [Phaseolus... 202 5e-58 XP_003538522.1 PREDICTED: pentatricopeptide repeat-containing pr... 201 6e-58 KYP57038.1 hypothetical protein KK1_003292 [Cajanus cajan] 194 7e-56 XP_018844776.1 PREDICTED: pentatricopeptide repeat-containing pr... 190 1e-53 XP_004502213.1 PREDICTED: pentatricopeptide repeat-containing pr... 189 2e-53 XP_016188467.1 PREDICTED: pentatricopeptide repeat-containing pr... 186 5e-52 XP_015953237.1 PREDICTED: pentatricopeptide repeat-containing pr... 184 1e-51 OAY24567.1 hypothetical protein MANES_17G025500 [Manihot esculenta] 184 2e-51 XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing pr... 182 8e-51 XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing pr... 181 2e-50 XP_003601624.1 PPR containing plant-like protein [Medicago trunc... 181 2e-50 XP_012082721.1 PREDICTED: pentatricopeptide repeat-containing pr... 181 3e-50 XP_002276556.1 PREDICTED: pentatricopeptide repeat-containing pr... 179 1e-49 XP_011008363.1 PREDICTED: pentatricopeptide repeat-containing pr... 179 1e-49 XP_009125125.1 PREDICTED: pentatricopeptide repeat-containing pr... 179 2e-49 XP_011098561.1 PREDICTED: pentatricopeptide repeat-containing pr... 178 3e-49 XP_015902775.1 PREDICTED: pentatricopeptide repeat-containing pr... 178 3e-49 >XP_003552765.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 658 Score = 206 bits (525), Expect = 7e-60 Identities = 100/115 (86%), Positives = 109/115 (94%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 Y DRSVDMEELL++IGQT NE+EL+AVMSPYN RQLS+RFM SLLSREPDWQRALALLDW Sbjct: 65 YWDRSVDMEELLAAIGQTQNEDELYAVMSPYNGRQLSMRFMVSLLSREPDWQRALALLDW 124 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 +NDKALYSPSL AYNV+LRNVLR+KQ+HLAHGLFDEMR KGLSPDRYTYSTLITS Sbjct: 125 INDKALYSPSLFAYNVLLRNVLRAKQWHLAHGLFDEMRQKGLSPDRYTYSTLITS 179 >XP_017407754.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vigna angularis] KOM27530.1 hypothetical protein LR48_Vigan434s000600 [Vigna angularis] Length = 676 Score = 204 bits (518), Expect = 9e-59 Identities = 97/114 (85%), Positives = 109/114 (95%) Frame = -1 Query: 343 MDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDWM 164 +DRSVDMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR LALLDW+ Sbjct: 84 LDRSVDMEELLAAIGETQNEDELYAVMSPYSGRQLSIRFMVSLLSREPDWQRTLALLDWI 143 Query: 163 NDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 N+KALYSPSL AYNVVLRNVLR+KQ+HLAHGLFDEMRHKGLSPDRYTYSTLITS Sbjct: 144 NEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITS 197 >XP_014521683.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vigna radiata var. radiata] Length = 676 Score = 203 bits (516), Expect = 2e-58 Identities = 97/114 (85%), Positives = 109/114 (95%) Frame = -1 Query: 343 MDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDWM 164 +DRSVDMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR LALLDW+ Sbjct: 84 LDRSVDMEELLAAIGETQNEDELYAVMSPYSGRQLSMRFMVSLLSREPDWQRTLALLDWI 143 Query: 163 NDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 N+KALYSPSL AYNVVLRNVLR+KQ+HLAHGLFDEMRHKGLSPDRYTYSTLITS Sbjct: 144 NEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITS 197 >XP_007163838.1 hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] ESW35832.1 hypothetical protein PHAVU_001G268500g [Phaseolus vulgaris] Length = 677 Score = 202 bits (513), Expect = 5e-58 Identities = 95/115 (82%), Positives = 110/115 (95%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 ++DRS+DMEELL++IG+T NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQR +ALLDW Sbjct: 84 FLDRSMDMEELLAAIGETQNEDELYAVMSPYSGRQLSMRFMVSLLSREPDWQRTVALLDW 143 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 +N+KALYSPSL AYNVVLRNVLR+KQ+HLAHGLFDEMRHKGLSPDRYTYSTLITS Sbjct: 144 INEKALYSPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITS 198 >XP_003538522.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Glycine max] Length = 667 Score = 201 bits (512), Expect = 6e-58 Identities = 97/114 (85%), Positives = 107/114 (93%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 Y+DRSVDME LL++IGQT NE+EL+AVMSPYN RQLS+RFM SLLSREPDWQRALALLDW Sbjct: 74 YLDRSVDMEVLLAAIGQTQNEDELYAVMSPYNGRQLSMRFMVSLLSREPDWQRALALLDW 133 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 +NDKALY PSL AYNV+LRNVLR+KQ+HLAHGLFDEMR KGLSPDRYTYSTLIT Sbjct: 134 INDKALYRPSLFAYNVLLRNVLRAKQWHLAHGLFDEMRQKGLSPDRYTYSTLIT 187 >KYP57038.1 hypothetical protein KK1_003292 [Cajanus cajan] Length = 587 Score = 194 bits (494), Expect = 7e-56 Identities = 94/108 (87%), Positives = 103/108 (95%) Frame = -1 Query: 325 MEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDWMNDKALY 146 MEELL++IGQT NE+EL+AVMSPY+ RQLS+RFM SLLSREPDWQRALALLDW+NDKA Y Sbjct: 1 MEELLAAIGQTQNEDELYAVMSPYSARQLSIRFMVSLLSREPDWQRALALLDWINDKAHY 60 Query: 145 SPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 SPSL AYNVVLRNVLR+KQ+HLAHGLFDEMRHKGLSPDRYTYSTLITS Sbjct: 61 SPSLFAYNVVLRNVLRAKQWHLAHGLFDEMRHKGLSPDRYTYSTLITS 108 >XP_018844776.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Juglans regia] Length = 687 Score = 190 bits (483), Expect = 1e-53 Identities = 86/117 (73%), Positives = 109/117 (93%) Frame = -1 Query: 355 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 176 EP+++D SVDM+ELL+SIGQT NE+EL+++MSPY RQLS+RFM S+LSREPDWQR+LAL Sbjct: 94 EPVHLDHSVDMDELLTSIGQTQNEQELYSLMSPYKGRQLSIRFMVSMLSREPDWQRSLAL 153 Query: 175 LDWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 LDW+N++ALYSPS+ AYNVV+RNVLR+KQ+ +AHGLF+EMRH+ L+PDRYTYSTLIT Sbjct: 154 LDWINEEALYSPSVFAYNVVMRNVLRAKQWDIAHGLFEEMRHRALAPDRYTYSTLIT 210 >XP_004502213.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Cicer arietinum] Length = 669 Score = 189 bits (481), Expect = 2e-53 Identities = 90/117 (76%), Positives = 104/117 (88%) Frame = -1 Query: 355 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 176 +P Y+DR+V+M ELL+SIGQT N ++LHAVMSPYN LS+RFM SLLSREPDWQRALAL Sbjct: 72 QPTYLDRTVNMNELLTSIGQTQNVQQLHAVMSPYNGTNLSIRFMVSLLSREPDWQRALAL 131 Query: 175 LDWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 LDWMN+KA YSPS+ AYNVVLRNVLR+KQ+ AHGLFDEMR KG+SPD+YTYSTLIT Sbjct: 132 LDWMNEKARYSPSVSAYNVVLRNVLRAKQWLFAHGLFDEMRQKGISPDKYTYSTLIT 188 >XP_016188467.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] XP_016188468.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] XP_016188469.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis ipaensis] Length = 661 Score = 186 bits (471), Expect = 5e-52 Identities = 87/114 (76%), Positives = 104/114 (91%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 ++D +VDM+EL+SSI QT N EEL+A+MSPYN RQLS+RFM SLLSREPDWQR+LALLDW Sbjct: 68 FLDHAVDMDELISSIRQTQNAEELYALMSPYNGRQLSMRFMVSLLSREPDWQRSLALLDW 127 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 +ND ALYSPS+ AYNVV+RNVLR+KQ+ +AHGLFDEMR +GL+PDRYTYSTLIT Sbjct: 128 INDTALYSPSVFAYNVVIRNVLRAKQWQVAHGLFDEMRQRGLAPDRYTYSTLIT 181 >XP_015953237.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953238.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953239.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] XP_015953240.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Arachis duranensis] Length = 661 Score = 184 bits (468), Expect = 1e-51 Identities = 87/114 (76%), Positives = 103/114 (90%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 ++D VDM+EL+SSI QT N EEL+A+MSPYN RQLS+RFM SLLSREPDWQR+LALLDW Sbjct: 68 FLDHIVDMDELISSIRQTQNAEELYALMSPYNGRQLSMRFMVSLLSREPDWQRSLALLDW 127 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 +ND ALYSPS+ AYNVV+RNVLR+KQ+ +AHGLFDEMR +GL+PDRYTYSTLIT Sbjct: 128 INDMALYSPSVFAYNVVIRNVLRAKQWQVAHGLFDEMRQRGLAPDRYTYSTLIT 181 >OAY24567.1 hypothetical protein MANES_17G025500 [Manihot esculenta] Length = 667 Score = 184 bits (467), Expect = 2e-51 Identities = 86/117 (73%), Positives = 104/117 (88%) Frame = -1 Query: 355 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 176 EP+Y+D S+DM+ELLSSI QT NE+EL++++SPY DRQLS+RFM SLLS E DW+R+LAL Sbjct: 71 EPVYLDHSLDMDELLSSISQTQNEQELYSLLSPYKDRQLSIRFMVSLLSHESDWERSLAL 130 Query: 175 LDWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 LDW+ND A YSPS+ AYNVVLRNVLR+KQ+ LAHGLFDEMR + L+PDRYTYSTLIT Sbjct: 131 LDWINDVARYSPSVFAYNVVLRNVLRAKQWELAHGLFDEMRKRALAPDRYTYSTLIT 187 >XP_008230711.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Prunus mume] Length = 677 Score = 182 bits (463), Expect = 8e-51 Identities = 83/117 (70%), Positives = 106/117 (90%) Frame = -1 Query: 352 PLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALL 173 P ++D S+DM+ELLSSIGQT NE+EL+++MS Y RQLS+RFM SLLSREPDWQR+LA+L Sbjct: 85 PSHLDHSIDMDELLSSIGQTQNEQELYSLMSTYKGRQLSIRFMVSLLSREPDWQRSLAIL 144 Query: 172 DWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 DW+N++ALY+PS+ AYNVV+RNVLR+KQ+ +AHGLF+EMR + L+PDRYTYSTLITS Sbjct: 145 DWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFEEMRQRALAPDRYTYSTLITS 201 >XP_008379319.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Malus domestica] Length = 677 Score = 181 bits (460), Expect = 2e-50 Identities = 84/117 (71%), Positives = 105/117 (89%) Frame = -1 Query: 352 PLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALL 173 P ++D SVDM+ELLSSIGQT NE+EL+++MS Y RQLS+RFM SLLSRE DWQR+LA+L Sbjct: 85 PSHLDHSVDMDELLSSIGQTQNEQELYSLMSAYKGRQLSIRFMVSLLSRESDWQRSLAIL 144 Query: 172 DWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 DW+N++ALY+PS+ AYNVV+RNVLR+KQ+ +AHGLFDEMR + L+PDRYTYSTLITS Sbjct: 145 DWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFDEMRQRALAPDRYTYSTLITS 201 >XP_003601624.1 PPR containing plant-like protein [Medicago truncatula] AES71875.1 PPR containing plant-like protein [Medicago truncatula] Length = 684 Score = 181 bits (460), Expect = 2e-50 Identities = 86/114 (75%), Positives = 101/114 (88%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 YMDRSVDM ELL+SI QT N E+L++++SPYN RQLS+RFM S+LSREPDWQR+LA+LDW Sbjct: 90 YMDRSVDMNELLTSIAQTQNIEQLYSILSPYNGRQLSIRFMISILSREPDWQRSLAILDW 149 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 MN+ A YSPSL YNVV+RNVLR+KQ+ LAHGLFDEM KGLSPD+YTYSTLIT Sbjct: 150 MNEIAQYSPSLNVYNVVIRNVLRAKQWQLAHGLFDEMLQKGLSPDKYTYSTLIT 203 >XP_012082721.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Jatropha curcas] KDP45457.1 hypothetical protein JCGZ_09706 [Jatropha curcas] Length = 667 Score = 181 bits (459), Expect = 3e-50 Identities = 83/117 (70%), Positives = 103/117 (88%) Frame = -1 Query: 355 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 176 +P+Y+D S+DM+ELL+SI QT NE+EL+ ++SP+ DRQLS+RFM SLLSRE DWQR+LA+ Sbjct: 75 QPVYLDHSIDMDELLTSISQTQNEQELYCLLSPFKDRQLSIRFMVSLLSRESDWQRSLAV 134 Query: 175 LDWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 LDW+ND A YSPS+ AYNVVLRNVLR KQ+ +AHGLFDEMR + L+PDRYTYSTLIT Sbjct: 135 LDWINDIARYSPSVFAYNVVLRNVLRDKQWEVAHGLFDEMRQRALAPDRYTYSTLIT 191 >XP_002276556.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Vitis vinifera] CBI35026.3 unnamed protein product, partial [Vitis vinifera] Length = 675 Score = 179 bits (455), Expect = 1e-49 Identities = 83/115 (72%), Positives = 104/115 (90%) Frame = -1 Query: 349 LYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLD 170 +++D SVDM+ELL+SI QT NE+EL+++MSPY RQLS+RFM SLLSREPDWQR+LALLD Sbjct: 84 VHLDHSVDMDELLASISQTSNEQELYSLMSPYKGRQLSIRFMVSLLSREPDWQRSLALLD 143 Query: 169 WMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 W+N++A YSPS+ AYNVV+RNVLR+KQ+ LAHGLF+EMR + L+PDRYTYSTLIT Sbjct: 144 WINEEASYSPSVFAYNVVIRNVLRAKQWELAHGLFEEMRQRALAPDRYTYSTLIT 198 >XP_011008363.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Populus euphratica] Length = 670 Score = 179 bits (454), Expect = 1e-49 Identities = 84/117 (71%), Positives = 103/117 (88%) Frame = -1 Query: 355 EPLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALAL 176 EP+Y+D SVDM ELL SI QT NE++L++++SPY DRQLS+RFM S++SRE DWQR+LAL Sbjct: 75 EPVYLDHSVDMTELLLSISQTQNEQQLYSLLSPYKDRQLSIRFMVSVISRESDWQRSLAL 134 Query: 175 LDWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 LDW+ND A YSPS+ AYNVVLRNVLR+KQ+ AHGLFDEMR++ L+PDRYTYSTLIT Sbjct: 135 LDWINDIAQYSPSVFAYNVVLRNVLRAKQWDHAHGLFDEMRNRALAPDRYTYSTLIT 191 >XP_009125125.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Brassica rapa] Length = 675 Score = 179 bits (453), Expect = 2e-49 Identities = 84/115 (73%), Positives = 102/115 (88%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 ++D VDM+ELL+SI QTHNEEEL +++S Y DRQLS+RFM SLLSRE DWQR+LALLDW Sbjct: 82 FLDHKVDMDELLASIHQTHNEEELFSLLSLYKDRQLSIRFMVSLLSREQDWQRSLALLDW 141 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLITS 2 ++D+A Y+PS+ AYNVVLRNVLR+KQF +AHGLFDEMR + L+PDRYTYSTLITS Sbjct: 142 VHDEAKYTPSVFAYNVVLRNVLRAKQFEIAHGLFDEMRQRALAPDRYTYSTLITS 196 >XP_011098561.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic [Sesamum indicum] Length = 676 Score = 178 bits (452), Expect = 3e-49 Identities = 86/114 (75%), Positives = 102/114 (89%) Frame = -1 Query: 346 YMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALLDW 167 ++D SVDMEELLSSIGQT +E EL+++MS Y R LSVRFM +LLSREPDWQR+LALLDW Sbjct: 87 FLDHSVDMEELLSSIGQTSDEHELYSLMSLYKSRSLSVRFMVALLSREPDWQRSLALLDW 146 Query: 166 MNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 MN++ALYSPS+ AYNVVLRNVLR+KQ+ +A+GLFDEMR + LSPDRYTYSTLIT Sbjct: 147 MNEEALYSPSVFAYNVVLRNVLRAKQWEVAYGLFDEMRGRALSPDRYTYSTLIT 200 >XP_015902775.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39980, chloroplastic-like [Ziziphus jujuba] Length = 683 Score = 178 bits (452), Expect = 3e-49 Identities = 81/116 (69%), Positives = 103/116 (88%) Frame = -1 Query: 352 PLYMDRSVDMEELLSSIGQTHNEEELHAVMSPYNDRQLSVRFMASLLSREPDWQRALALL 173 P Y+D SVDM+ELL SIGQT NE EL++++SPY RQLS++FM SLLSRE DWQR+LA+L Sbjct: 91 PAYLDHSVDMDELLVSIGQTQNEHELYSLLSPYKGRQLSIKFMVSLLSRESDWQRSLAIL 150 Query: 172 DWMNDKALYSPSLIAYNVVLRNVLRSKQFHLAHGLFDEMRHKGLSPDRYTYSTLIT 5 DW+N++ALY+PS+ AYNVV+RNVLR+KQ+ +AHGLF+EMR + L+PDRYTYSTLIT Sbjct: 151 DWINEEALYTPSVFAYNVVIRNVLRAKQWEIAHGLFEEMRQRALAPDRYTYSTLIT 206