BLASTX nr result
ID: Glycyrrhiza28_contig00008048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00008048 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016185822.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 XP_015956612.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 GAU18246.1 hypothetical protein TSUD_175880 [Trifolium subterran... 87 1e-17 XP_004514268.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 7e-16 XP_019462294.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 1e-15 XP_013448704.1 PPR containing plant-like protein [Medicago trunc... 81 2e-15 KHN11005.1 Pentatricopeptide repeat-containing protein, chloropl... 80 3e-15 XP_003532287.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-15 KOM37911.1 hypothetical protein LR48_Vigan03g129300 [Vigna angul... 79 9e-15 KYP48852.1 hypothetical protein KK1_029412 [Cajanus cajan] 78 1e-14 XP_014498267.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 XP_017419488.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 XP_007140612.1 hypothetical protein PHAVU_008G126700g [Phaseolus... 78 2e-14 XP_011024658.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 OAY34764.1 hypothetical protein MANES_12G045500 [Manihot esculenta] 65 6e-10 XP_018818044.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_002303044.1 pentatricopeptide repeat-containing family protei... 64 2e-09 XP_012076812.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 XP_015581300.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-08 KVI12297.1 Pentatricopeptide repeat-containing protein [Cynara c... 59 1e-07 >XP_016185822.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis ipaensis] XP_016185829.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis ipaensis] Length = 520 Score = 87.4 bits (215), Expect = 1e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 +GCKPDIITYRTMIKAYSFKGMHS VKELR L+T V+RPP KR KPDF Sbjct: 473 RGCKPDIITYRTMIKAYSFKGMHSHVKELRELITMVQRPPLKRKKPDF 520 >XP_015956612.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis duranensis] XP_015956617.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Arachis duranensis] Length = 520 Score = 87.4 bits (215), Expect = 1e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 +GCKPDIITYRTMIKAYSFKGMHS VKELR L+T V+RPP KR KPDF Sbjct: 473 RGCKPDIITYRTMIKAYSFKGMHSHVKELRELITMVQRPPLKRKKPDF 520 >GAU18246.1 hypothetical protein TSUD_175880 [Trifolium subterraneum] Length = 379 Score = 86.7 bits (213), Expect = 1e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD ITYRTMIKAYS KGMHS VKELR LLTTVK+PP +R+KPDF Sbjct: 332 KGCKPDFITYRTMIKAYSSKGMHSHVKELRELLTTVKKPPFERNKPDF 379 >XP_004514268.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Cicer arietinum] Length = 520 Score = 82.4 bits (202), Expect = 7e-16 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD ITYRTMIKAYS KGM S VKELR LL TVKRPP +R+KPDF Sbjct: 473 KGCKPDFITYRTMIKAYSSKGMQSHVKELRELLITVKRPPLERNKPDF 520 >XP_019462294.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Lupinus angustifolius] OIW01278.1 hypothetical protein TanjilG_10439 [Lupinus angustifolius] Length = 511 Score = 81.6 bits (200), Expect = 1e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 +GCKPD+ITYRTMIKAYSFKGM+S VKEL LL TV+RPP KR KPDF Sbjct: 464 RGCKPDLITYRTMIKAYSFKGMNSHVKELTELLATVQRPPIKRLKPDF 511 >XP_013448704.1 PPR containing plant-like protein [Medicago truncatula] KEH22731.1 PPR containing plant-like protein [Medicago truncatula] Length = 508 Score = 81.3 bits (199), Expect = 2e-15 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD ITYRTMIKAYS KGM S VKEL+ LL TVKRPP +R+KPDF Sbjct: 461 KGCKPDFITYRTMIKAYSSKGMDSHVKELKELLATVKRPPLERNKPDF 508 >KHN11005.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 416 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDI+TYRTMIK Y++KGM S KELR LL TV RPP KRDKPDF Sbjct: 370 GCKPDIVTYRTMIKTYTYKGMDSHAKELRELLPTVNRPPLKRDKPDF 416 >XP_003532287.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Glycine max] KRH46714.1 hypothetical protein GLYMA_08G352500 [Glycine max] Length = 515 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDI+TYRTMIK Y++KGM S KELR LL TV RPP KRDKPDF Sbjct: 469 GCKPDIVTYRTMIKTYTYKGMDSHAKELRELLPTVNRPPLKRDKPDF 515 >KOM37911.1 hypothetical protein LR48_Vigan03g129300 [Vigna angularis] BAT84349.1 hypothetical protein VIGAN_04169100 [Vigna angularis var. angularis] Length = 350 Score = 78.6 bits (192), Expect = 9e-15 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDIITYRTMIKAYSF GM S KE+R LL TV RP KRDKPDF Sbjct: 304 GCKPDIITYRTMIKAYSFNGMDSHAKEIRELLPTVTRPSLKRDKPDF 350 >KYP48852.1 hypothetical protein KK1_029412 [Cajanus cajan] Length = 357 Score = 78.2 bits (191), Expect = 1e-14 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDIITYRTMIKAY+ KGM S KELR LL TV RP KRDKPDF Sbjct: 311 GCKPDIITYRTMIKAYTIKGMDSHAKELRELLPTVNRPAFKRDKPDF 357 >XP_014498267.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Vigna radiata var. radiata] Length = 512 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDIITYRTMIKAYSF GM S KE+R LL TV RP KRDKPDF Sbjct: 466 GCKPDIITYRTMIKAYSFNGMDSHAKEIRELLPTVTRPSLKRDKPDF 512 >XP_017419488.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Vigna angularis] Length = 514 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/47 (78%), Positives = 38/47 (80%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDIITYRTMIKAYSF GM S KE+R LL TV RP KRDKPDF Sbjct: 468 GCKPDIITYRTMIKAYSFNGMDSHAKEIRELLPTVTRPSLKRDKPDF 514 >XP_007140612.1 hypothetical protein PHAVU_008G126700g [Phaseolus vulgaris] ESW12606.1 hypothetical protein PHAVU_008G126700g [Phaseolus vulgaris] Length = 513 Score = 78.2 bits (191), Expect = 2e-14 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 6 GCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 GCKPDIITYRTMIKAYSFKGM + KE+R LL TV RP +RDKPDF Sbjct: 467 GCKPDIITYRTMIKAYSFKGMDAHAKEIRELLPTVTRPSLRRDKPDF 513 >XP_011024658.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Populus euphratica] XP_011024659.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Populus euphratica] XP_011024660.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Populus euphratica] Length = 511 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD +TYRTMIKAYS KGM S KELR LL +V+ S++ KPDF Sbjct: 464 KGCKPDKVTYRTMIKAYSIKGMTSHAKELRNLLGSVEVTRSQKKKPDF 511 >OAY34764.1 hypothetical protein MANES_12G045500 [Manihot esculenta] Length = 540 Score = 65.5 bits (158), Expect = 6e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD ITYRTMIKAYS KGM VKEL+ L +V+ P +R KPDF Sbjct: 492 KGCKPDKITYRTMIKAYSSKGMTKHVKELQDLARSVEGPQFQRKKPDF 539 >XP_018818044.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] XP_018818045.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] XP_018818046.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] XP_018818047.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] XP_018818048.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] XP_018818050.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Juglans regia] Length = 522 Score = 64.7 bits (156), Expect = 1e-09 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD ITYRTMIKAYS KGM + VKEL+ L+ + + P + KPDF Sbjct: 474 KGCKPDRITYRTMIKAYSIKGMTTHVKELQNLIGSADKTPPEMGKPDF 521 >XP_002303044.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE82317.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 485 Score = 63.9 bits (154), Expect = 2e-09 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCKPD +TYRTMIKAYS KGM S K+LR LL +V+ S + KPDF Sbjct: 438 KGCKPDKVTYRTMIKAYSIKGMTSHAKKLRNLLGSVEVTRSPKKKPDF 485 >XP_012076812.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Jatropha curcas] KDP45579.1 hypothetical protein JCGZ_17186 [Jatropha curcas] Length = 520 Score = 60.8 bits (146), Expect = 2e-08 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KGCK D ITYRTMI AYS KGM KEL+ L+ + +RP R+KPDF Sbjct: 473 KGCKADKITYRTMINAYSSKGMTKHAKELQDLVVSAERPRLHRNKPDF 520 >XP_015581300.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Ricinus communis] XP_015581301.1 PREDICTED: pentatricopeptide repeat-containing protein At5g48730, chloroplastic [Ricinus communis] Length = 513 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKRDKPDF 146 KG +PD ITYRTMIKAYS KGM VKEL+ L+ +V+ P R KPDF Sbjct: 466 KGYRPDKITYRTMIKAYSSKGMTKHVKELQDLVASVEGPQLHRKKPDF 513 >KVI12297.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 406 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 3 KGCKPDIITYRTMIKAYSFKGMHSQVKELRALLTTVKRPPSKR 131 KGC+PD ITYRTMIKAY+ GM + VKELR L++V +P S+R Sbjct: 364 KGCQPDKITYRTMIKAYNMNGMSNHVKELRHALSSVGKPESRR 406