BLASTX nr result
ID: Glycyrrhiza28_contig00008002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00008002 (224 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO54711.1 Calcium-binding EF-hand [Corchorus capsularis] OMO996... 63 1e-10 XP_017632992.1 PREDICTED: calmodulin-like protein 8 [Gossypium a... 63 1e-10 XP_012481927.1 PREDICTED: calmodulin-like protein 8 [Gossypium r... 63 1e-10 XP_016730661.1 PREDICTED: calmodulin-like protein 8 [Gossypium h... 62 2e-10 XP_007034907.1 PREDICTED: calmodulin-like protein 8 [Theobroma c... 62 3e-10 XP_002283755.1 PREDICTED: calmodulin-like protein 11 [Vitis vini... 61 6e-10 XP_009337272.1 PREDICTED: calmodulin-like protein 11 isoform X2 ... 61 6e-10 XP_009376002.1 PREDICTED: calmodulin-like protein 11 [Pyrus x br... 61 6e-10 XP_008341030.1 PREDICTED: calmodulin-like protein 11 isoform X2 ... 61 6e-10 XP_008224219.1 PREDICTED: calmodulin-like protein 11 [Prunus mume] 61 6e-10 XP_007223678.1 hypothetical protein PRUPE_ppa012907mg [Prunus pe... 61 6e-10 XP_008391015.1 PREDICTED: calmodulin-like protein 11 isoform X2 ... 60 8e-10 XP_008364032.1 PREDICTED: calmodulin-like [Malus domestica] 60 1e-09 XP_007143895.1 hypothetical protein PHAVU_007G111200g [Phaseolus... 59 2e-09 XP_015876504.1 PREDICTED: calmodulin-like protein 8 [Ziziphus ju... 59 2e-09 XP_004296596.1 PREDICTED: calmodulin-like protein 11 isoform X2 ... 59 2e-09 XP_014512115.1 PREDICTED: calmodulin-like protein 11 [Vigna radi... 59 3e-09 XP_004302046.1 PREDICTED: calmodulin-like protein 11 [Fragaria v... 59 5e-09 XP_004134112.1 PREDICTED: calmodulin-like protein 11 [Cucumis sa... 59 5e-09 XP_011027358.1 PREDICTED: calmodulin-like protein 11 [Populus eu... 58 7e-09 >OMO54711.1 Calcium-binding EF-hand [Corchorus capsularis] OMO99636.1 Calcium-binding EF-hand [Corchorus olitorius] Length = 150 Score = 62.8 bits (151), Expect = 1e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MGD+LSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MGDILSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_017632992.1 PREDICTED: calmodulin-like protein 8 [Gossypium arboreum] Length = 150 Score = 62.8 bits (151), Expect = 1e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MGD+LSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MGDILSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_012481927.1 PREDICTED: calmodulin-like protein 8 [Gossypium raimondii] XP_016714258.1 PREDICTED: calmodulin-like protein 8 [Gossypium hirsutum] KJB28407.1 hypothetical protein B456_005G046000 [Gossypium raimondii] Length = 150 Score = 62.8 bits (151), Expect = 1e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MGD+LSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MGDILSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_016730661.1 PREDICTED: calmodulin-like protein 8 [Gossypium hirsutum] Length = 150 Score = 62.0 bits (149), Expect = 2e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MGD+LSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MGDMLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_007034907.1 PREDICTED: calmodulin-like protein 8 [Theobroma cacao] EOY05833.1 Calmodulin 8 isoform 1 [Theobroma cacao] Length = 152 Score = 61.6 bits (148), Expect = 3e-10 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MGD+L+EEQIV+FKEAFCLFDKDGDGCIT Sbjct: 3 MGDILTEEQIVEFKEAFCLFDKDGDGCIT 31 >XP_002283755.1 PREDICTED: calmodulin-like protein 11 [Vitis vinifera] CAN70418.1 hypothetical protein VITISV_013814 [Vitis vinifera] CBI26332.3 unnamed protein product, partial [Vitis vinifera] Length = 149 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_009337272.1 PREDICTED: calmodulin-like protein 11 isoform X2 [Pyrus x bretschneideri] Length = 150 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_009376002.1 PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri] AMY59975.1 calmodulin 5 [Pyrus x bretschneideri] Length = 150 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_008341030.1 PREDICTED: calmodulin-like protein 11 isoform X2 [Malus domestica] Length = 150 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_008224219.1 PREDICTED: calmodulin-like protein 11 [Prunus mume] Length = 150 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_007223678.1 hypothetical protein PRUPE_ppa012907mg [Prunus persica] ONI26419.1 hypothetical protein PRUPE_1G023600 [Prunus persica] Length = 150 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_008391015.1 PREDICTED: calmodulin-like protein 11 isoform X2 [Malus domestica] Length = 150 Score = 60.5 bits (145), Expect = 8e-10 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLSEEQIV+FKEAFC+FDKDGDGCIT Sbjct: 1 MADVLSEEQIVEFKEAFCJFDKDGDGCIT 29 >XP_008364032.1 PREDICTED: calmodulin-like [Malus domestica] Length = 154 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +1 Query: 124 IAYTMGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 + + MG+VL+EEQIV+F+EAFCLFDKDGDGCIT Sbjct: 2 VKHRMGEVLTEEQIVEFQEAFCLFDKDGDGCIT 34 >XP_007143895.1 hypothetical protein PHAVU_007G111200g [Phaseolus vulgaris] ESW15889.1 hypothetical protein PHAVU_007G111200g [Phaseolus vulgaris] Length = 118 Score = 58.9 bits (141), Expect = 2e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 133 TMGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 TM DVLSEEQIVDFKEAF LFDKDGDGCIT Sbjct: 2 TMTDVLSEEQIVDFKEAFGLFDKDGDGCIT 31 >XP_015876504.1 PREDICTED: calmodulin-like protein 8 [Ziziphus jujuba] Length = 150 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M DVLS+EQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MADVLSKEQIVEFKEAFCLFDKDGDGCIT 29 >XP_004296596.1 PREDICTED: calmodulin-like protein 11 isoform X2 [Fragaria vesca subsp. vesca] Length = 150 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M +VLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MAEVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_014512115.1 PREDICTED: calmodulin-like protein 11 [Vigna radiata var. radiata] XP_017413519.1 PREDICTED: calmodulin-like protein 11 [Vigna angularis] KOM35594.1 hypothetical protein LR48_Vigan02g174400 [Vigna angularis] BAT94818.1 hypothetical protein VIGAN_08146000 [Vigna angularis var. angularis] Length = 152 Score = 58.9 bits (141), Expect = 3e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 133 TMGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 TM DVLSEEQIVDFKEAF LFDKDGDGCIT Sbjct: 2 TMTDVLSEEQIVDFKEAFGLFDKDGDGCIT 31 >XP_004302046.1 PREDICTED: calmodulin-like protein 11 [Fragaria vesca subsp. vesca] Length = 150 Score = 58.5 bits (140), Expect = 5e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 MG+VLSEEQI +F+EAFCLFDKDGDGCIT Sbjct: 1 MGEVLSEEQIAEFQEAFCLFDKDGDGCIT 29 >XP_004134112.1 PREDICTED: calmodulin-like protein 11 [Cucumis sativus] XP_008438603.1 PREDICTED: calmodulin-like protein 11 [Cucumis melo] KGN56931.1 hypothetical protein Csa_3G144210 [Cucumis sativus] Length = 150 Score = 58.5 bits (140), Expect = 5e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M +VLSEEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MTEVLSEEQIVEFKEAFCLFDKDGDGCIT 29 >XP_011027358.1 PREDICTED: calmodulin-like protein 11 [Populus euphratica] Length = 150 Score = 58.2 bits (139), Expect = 7e-09 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 136 MGDVLSEEQIVDFKEAFCLFDKDGDGCIT 222 M +VL+EEQIV+FKEAFCLFDKDGDGCIT Sbjct: 1 MAEVLTEEQIVEFKEAFCLFDKDGDGCIT 29