BLASTX nr result
ID: Glycyrrhiza28_contig00007762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007762 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU34598.1 hypothetical protein TSUD_15130 [Trifolium subterraneum] 126 2e-33 KRH18080.1 hypothetical protein GLYMA_13G036400 [Glycine max] KR... 120 2e-31 XP_014620760.1 PREDICTED: ACT domain-containing protein ACR3-lik... 120 2e-31 XP_003541896.1 PREDICTED: ACT domain-containing protein ACR3-lik... 120 6e-31 KYP73258.1 [Protein-PII] uridylyltransferase [Cajanus cajan] 120 8e-31 KRH16487.1 hypothetical protein GLYMA_14G158900 [Glycine max] KR... 119 8e-31 KRH16490.1 hypothetical protein GLYMA_14G158900 [Glycine max] KR... 119 9e-31 XP_007161397.1 hypothetical protein PHAVU_001G065500g [Phaseolus... 115 2e-30 KYP37811.1 [Protein-PII] uridylyltransferase, partial [Cajanus c... 117 2e-30 XP_006596251.1 PREDICTED: ACT domain-containing protein ACR3-lik... 119 3e-30 BAT82174.1 hypothetical protein VIGAN_03214300 [Vigna angularis ... 117 4e-30 XP_013466441.1 four ACT domain ACT domain protein which protein ... 119 6e-30 XP_019426043.1 PREDICTED: ACT domain-containing protein ACR3-lik... 118 6e-30 XP_019426018.1 PREDICTED: ACT domain-containing protein ACR3-lik... 118 6e-30 XP_007161398.1 hypothetical protein PHAVU_001G065500g [Phaseolus... 115 8e-30 XP_017431067.1 PREDICTED: ACT domain-containing protein ACR3-lik... 117 1e-29 XP_014502777.1 PREDICTED: ACT domain-containing protein ACR3 [Vi... 117 1e-29 XP_017431066.1 PREDICTED: ACT domain-containing protein ACR3-lik... 117 1e-29 XP_017431053.1 PREDICTED: ACT domain-containing protein ACR3-lik... 117 1e-29 AFK47621.1 unknown [Lotus japonicus] 113 2e-29 >GAU34598.1 hypothetical protein TSUD_15130 [Trifolium subterraneum] Length = 368 Score = 126 bits (316), Expect = 2e-33 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAG+TT TNVDCPPSFRPNI+IER EEKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 234 ADRDYESAGLTT---TNVDCPPSFRPNIKIERIEEKGYSVVSVRCKDRAKLMFDIVCTLT 290 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 291 DMEYVVFH 298 >KRH18080.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18081.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18082.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18083.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18084.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18085.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18086.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18087.1 hypothetical protein GLYMA_13G036400 [Glycine max] Length = 354 Score = 120 bits (302), Expect = 2e-31 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT T+VDCPP FRPNIRIER EKGYSVVSV+CKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTT---TDVDCPPCFRPNIRIERIVEKGYSVVSVKCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 287 DMEYVVFH 294 >XP_014620760.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X2 [Glycine max] Length = 374 Score = 120 bits (302), Expect = 2e-31 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT T+VDCPP FRPNIRIER EKGYSVVSV+CKDRAKLMFDIVCTLT Sbjct: 155 ADRDYESAGVTT---TDVDCPPCFRPNIRIERIVEKGYSVVSVKCKDRAKLMFDIVCTLT 211 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 212 DMEYVVFH 219 >XP_003541896.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] XP_006593772.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] XP_006593773.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] XP_006593775.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] XP_014620758.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] XP_014620759.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Glycine max] KHN24360.1 [Protein-PII] uridylyltransferase [Glycine soja] KRH18075.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18076.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18077.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18078.1 hypothetical protein GLYMA_13G036400 [Glycine max] KRH18079.1 hypothetical protein GLYMA_13G036400 [Glycine max] Length = 449 Score = 120 bits (302), Expect = 6e-31 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT T+VDCPP FRPNIRIER EKGYSVVSV+CKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTT---TDVDCPPCFRPNIRIERIVEKGYSVVSVKCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 287 DMEYVVFH 294 >KYP73258.1 [Protein-PII] uridylyltransferase [Cajanus cajan] Length = 444 Score = 120 bits (301), Expect = 8e-31 Identities = 60/68 (88%), Positives = 62/68 (91%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ T+VDC PSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 224 ADRDYESAGVTTT--TDVDCAPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 281 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 282 DMQYVVFH 289 >KRH16487.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16488.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16489.1 hypothetical protein GLYMA_14G158900 [Glycine max] Length = 353 Score = 119 bits (297), Expect = 8e-31 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYES G+TT T+VDCPPSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESVGLTT---TDVDCPPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 287 DMEYVVFH 294 >KRH16490.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16491.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16492.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16493.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16494.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16495.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16496.1 hypothetical protein GLYMA_14G158900 [Glycine max] Length = 356 Score = 119 bits (297), Expect = 9e-31 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYES G+TT T+VDCPPSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESVGLTT---TDVDCPPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 287 DMEYVVFH 294 >XP_007161397.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] XP_007161399.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] ESW33391.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] ESW33393.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] Length = 235 Score = 115 bits (288), Expect = 2e-30 Identities = 58/68 (85%), Positives = 59/68 (86%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DC PSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 155 ADRDYESAGVTTT-----DCAPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 209 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 210 DMQYVVFH 217 >KYP37811.1 [Protein-PII] uridylyltransferase, partial [Cajanus cajan] Length = 347 Score = 117 bits (294), Expect = 2e-30 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYES+GVTT +VDC PS RP I IERCEEKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 129 ADRDYESSGVTT----DVDCHPSLRPKITIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 184 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 185 DMQYVVFH 192 >XP_006596251.1 PREDICTED: ACT domain-containing protein ACR3-like [Glycine max] XP_006596252.1 PREDICTED: ACT domain-containing protein ACR3-like [Glycine max] XP_006596254.1 PREDICTED: ACT domain-containing protein ACR3-like [Glycine max] KRH16482.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16483.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16484.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16485.1 hypothetical protein GLYMA_14G158900 [Glycine max] KRH16486.1 hypothetical protein GLYMA_14G158900 [Glycine max] Length = 448 Score = 119 bits (297), Expect = 3e-30 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYES G+TT T+VDCPPSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESVGLTT---TDVDCPPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 287 DMEYVVFH 294 >BAT82174.1 hypothetical protein VIGAN_03214300 [Vigna angularis var. angularis] Length = 368 Score = 117 bits (293), Expect = 4e-30 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DCPPSFRP IRIER EKGYSVV+VRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTTT-----DCPPSFRPKIRIERIVEKGYSVVTVRCKDRAKLMFDIVCTLT 284 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 285 DMQYVVFH 292 >XP_013466441.1 four ACT domain ACT domain protein which protein [Medicago truncatula] KEH40482.1 four ACT domain ACT domain protein which protein [Medicago truncatula] Length = 683 Score = 119 bits (299), Expect = 6e-30 Identities = 59/68 (86%), Positives = 62/68 (91%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAG T++ TNVD PPSFRPNI IER EEKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 463 ADRDYESAGGVTTA-TNVDSPPSFRPNIEIERIEEKGYSVVSVRCKDRAKLMFDIVCTLT 521 Query: 182 DMQYVVFH 205 DM+YVVFH Sbjct: 522 DMEYVVFH 529 >XP_019426043.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X2 [Lupinus angustifolius] OIW17056.1 hypothetical protein TanjilG_15639 [Lupinus angustifolius] Length = 444 Score = 118 bits (295), Expect = 6e-30 Identities = 56/68 (82%), Positives = 61/68 (89%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRD+ES GVTT T+VDCPPS+RP I IE CEEKGYSVV+V+CKDRAKLMFDIVCTLT Sbjct: 230 ADRDFESPGVTT---TDVDCPPSYRPQISIEHCEEKGYSVVAVKCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 287 DMQYVVFH 294 >XP_019426018.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Lupinus angustifolius] XP_019426026.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Lupinus angustifolius] XP_019426035.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Lupinus angustifolius] Length = 447 Score = 118 bits (295), Expect = 6e-30 Identities = 56/68 (82%), Positives = 61/68 (89%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRD+ES GVTT T+VDCPPS+RP I IE CEEKGYSVV+V+CKDRAKLMFDIVCTLT Sbjct: 230 ADRDFESPGVTT---TDVDCPPSYRPQISIEHCEEKGYSVVAVKCKDRAKLMFDIVCTLT 286 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 287 DMQYVVFH 294 >XP_007161398.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] XP_007161400.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] ESW33392.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] ESW33394.1 hypothetical protein PHAVU_001G065500g [Phaseolus vulgaris] Length = 310 Score = 115 bits (288), Expect = 8e-30 Identities = 58/68 (85%), Positives = 59/68 (86%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DC PSFRP IRIER EKGYSVVSVRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTTT-----DCAPSFRPKIRIERIVEKGYSVVSVRCKDRAKLMFDIVCTLT 284 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 285 DMQYVVFH 292 >XP_017431067.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X3 [Vigna angularis] Length = 447 Score = 117 bits (293), Expect = 1e-29 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DCPPSFRP IRIER EKGYSVV+VRCKDRAKLMFDIVCTLT Sbjct: 231 ADRDYESAGVTTT-----DCPPSFRPKIRIERIVEKGYSVVTVRCKDRAKLMFDIVCTLT 285 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 286 DMQYVVFH 293 >XP_014502777.1 PREDICTED: ACT domain-containing protein ACR3 [Vigna radiata var. radiata] Length = 447 Score = 117 bits (293), Expect = 1e-29 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DCPPSFRP IRIER EKGYSVV+VRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTTT-----DCPPSFRPKIRIERIVEKGYSVVTVRCKDRAKLMFDIVCTLT 284 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 285 DMQYVVFH 292 >XP_017431066.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X2 [Vigna angularis] KOM48567.1 hypothetical protein LR48_Vigan07g227100 [Vigna angularis] Length = 447 Score = 117 bits (293), Expect = 1e-29 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DCPPSFRP IRIER EKGYSVV+VRCKDRAKLMFDIVCTLT Sbjct: 230 ADRDYESAGVTTT-----DCPPSFRPKIRIERIVEKGYSVVTVRCKDRAKLMFDIVCTLT 284 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 285 DMQYVVFH 292 >XP_017431053.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431054.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431055.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431056.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431057.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431059.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431060.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431061.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431062.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431063.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431064.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] XP_017431065.1 PREDICTED: ACT domain-containing protein ACR3-like isoform X1 [Vigna angularis] Length = 448 Score = 117 bits (293), Expect = 1e-29 Identities = 58/68 (85%), Positives = 60/68 (88%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYESAGVTT+ DCPPSFRP IRIER EKGYSVV+VRCKDRAKLMFDIVCTLT Sbjct: 231 ADRDYESAGVTTT-----DCPPSFRPKIRIERIVEKGYSVVTVRCKDRAKLMFDIVCTLT 285 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 286 DMQYVVFH 293 >AFK47621.1 unknown [Lotus japonicus] Length = 262 Score = 113 bits (282), Expect = 2e-29 Identities = 55/68 (80%), Positives = 59/68 (86%) Frame = +2 Query: 2 ADRDYESAGVTTSSSTNVDCPPSFRPNIRIERCEEKGYSVVSVRCKDRAKLMFDIVCTLT 181 ADRDYE A VTT++ +VDCP SFRP I IERC EKGYS VSV+CKDRAKLMFDIVCTLT Sbjct: 42 ADRDYERASVTTTTP-DVDCPLSFRPKIEIERCGEKGYSAVSVKCKDRAKLMFDIVCTLT 100 Query: 182 DMQYVVFH 205 DMQYVVFH Sbjct: 101 DMQYVVFH 108