BLASTX nr result
ID: Glycyrrhiza28_contig00007448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007448 (275 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1]... 120 7e-34 EDY48148.1 conserved hypothetical protein [Streptomyces clavulig... 120 1e-33 EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] 119 3e-33 EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] 117 2e-32 EDY62143.2 conserved hypothetical protein [Streptomyces pristina... 116 3e-32 AOE07156.1 hypothetical protein [uncultured bacterium] 117 4e-32 EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosp... 116 5e-32 OIO89803.1 hypothetical protein AUJ92_20605 [Armatimonadetes bac... 115 5e-32 EDN81768.1 hypothetical protein ACTODO_00002 [Actinomyces odonto... 115 5e-32 EFL02127.1 conserved hypothetical protein [Streptomyces sp. SPB78] 111 9e-30 CEH44546.1 conserved hypothetical protein [Xanthomonas citri pv.... 109 1e-29 AOE11689.1 hypothetical protein [uncultured bacterium] 109 3e-29 CEE39501.1 conserved hypothetical protein [Xanthomonas citri pv.... 108 5e-29 KMS64610.1 hypothetical protein BVRB_018500 [Beta vulgaris subsp... 108 1e-28 SIG42355.1 Uncharacterised protein [Mycobacterium abscessus subs... 106 2e-28 JAN31957.1 hypothetical protein [Daphnia magna] 105 6e-28 KMS94002.1 hypothetical protein BVRB_025780, partial [Beta vulga... 106 7e-28 EFE84355.1 conserved hypothetical protein, partial [Streptomyces... 103 4e-27 CKG78254.1 Uncharacterised protein [Corynebacterium diphtheriae]... 103 4e-27 JAN84548.1 hypothetical protein [Daphnia magna] 102 1e-26 >EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1] EFL16481.1 conserved hypothetical protein [Streptomyces sp. C] Length = 95 Score = 120 bits (302), Expect = 7e-34 Identities = 60/90 (66%), Positives = 63/90 (70%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 T + PP +RRKVG TSS H PY LG TRATM GT S+SQK S DW LQLD Sbjct: 3 THRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLD 62 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHH 5 MKSESLVIADQH CGEYVPG CTHRPS H Sbjct: 63 PMKSESLVIADQHCCGEYVPGPCTHRPSRH 92 >EDY48148.1 conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 120 bits (301), Expect = 1e-33 Identities = 59/90 (65%), Positives = 64/90 (71%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 T + PP +RRKVG TSS H PY LG TRATM GT+ + S+SQK S DW LQLD Sbjct: 3 THRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLD 62 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHH 5 MKSE LVIADQH CGEYVPG CTHRPS H Sbjct: 63 PMKSELLVIADQHCCGEYVPGPCTHRPSRH 92 >EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 119 bits (298), Expect = 3e-33 Identities = 59/86 (68%), Positives = 61/86 (70%) Frame = -2 Query: 262 PPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKS 83 PP +RRKVG TSS H PY LG TRATM GT S+SQK S DW LQLD MKS Sbjct: 7 PPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKS 66 Query: 82 ESLVIADQHRCGEYVPGSCTHRPSHH 5 ESLVIADQH CGEYVPG CTHRPS H Sbjct: 67 ESLVIADQHCCGEYVPGPCTHRPSRH 92 >EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] Length = 95 Score = 117 bits (292), Expect = 2e-32 Identities = 58/86 (67%), Positives = 60/86 (69%) Frame = -2 Query: 262 PPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKS 83 PP +RRKVG TSS H PY LG TRATM GT S+SQK S DW LQLD MKS Sbjct: 7 PPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKS 66 Query: 82 ESLVIADQHRCGEYVPGSCTHRPSHH 5 E LVIADQH CGEYVPG CTHRPS H Sbjct: 67 ELLVIADQHCCGEYVPGPCTHRPSRH 92 >EDY62143.2 conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 116 bits (291), Expect = 3e-32 Identities = 58/90 (64%), Positives = 63/90 (70%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 T + P +RRKVG TSS H PY LG TRATM GT+ + S+SQK S DW LQLD Sbjct: 3 THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLD 62 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHH 5 MKSE LVIADQH CGEYVPG CTHRPS H Sbjct: 63 PMKSELLVIADQHCCGEYVPGPCTHRPSRH 92 >AOE07156.1 hypothetical protein [uncultured bacterium] Length = 113 Score = 117 bits (292), Expect = 4e-32 Identities = 59/91 (64%), Positives = 66/91 (72%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 TL+ P + RK G TS+ HG YA GYTRATMV T+GS+ A+ S+SQK Y S DWSLQLD Sbjct: 8 TLERLPAQAERKAGTTSNHHGLYAQGYTRATMVRTKGSEPATVSESQKPYLSSDWSLQLD 67 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHHG 2 MK ESLVI Q GEYVPG CTHRPS HG Sbjct: 68 SMKLESLVIVGQQYYGEYVPGPCTHRPSSHG 98 >EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 116 bits (290), Expect = 5e-32 Identities = 59/90 (65%), Positives = 62/90 (68%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 T + P +RRKVG TSS H PY LG TRATM GT A S+SQK S DW LQLD Sbjct: 3 THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQLD 62 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHH 5 MKSE LVIADQH CGEYVPG CTHRPS H Sbjct: 63 PMKSELLVIADQHCCGEYVPGPCTHRPSRH 92 >OIO89803.1 hypothetical protein AUJ92_20605 [Armatimonadetes bacterium CG2_30_59_28] Length = 86 Score = 115 bits (289), Expect = 5e-32 Identities = 56/76 (73%), Positives = 59/76 (77%) Frame = -2 Query: 232 MTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSESLVIADQHR 53 MTSSPH PYALG T ATM GT+ S+ A S+SQKT S DWSLQLD MKSESLV A QH Sbjct: 1 MTSSPHAPYALGCTHATMAGTKSSKTARFSESQKTGPSSDWSLQLDSMKSESLVTAGQHY 60 Query: 52 CGEYVPGSCTHRPSHH 5 CGEYVPG CTHRPS H Sbjct: 61 CGEYVPGPCTHRPSRH 76 >EDN81768.1 hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 115 bits (289), Expect = 5e-32 Identities = 56/85 (65%), Positives = 61/85 (71%) Frame = -2 Query: 259 PVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSE 80 P ++RRKVGMTS+ H PY LG+T ATM GTEG S+S K S DW LQLD MK E Sbjct: 2 PGLTRRKVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVE 61 Query: 79 SLVIADQHRCGEYVPGSCTHRPSHH 5 SLVIADQ RCGEYV G CTHRPS H Sbjct: 62 SLVIADQQRCGEYVLGPCTHRPSRH 86 >EFL02127.1 conserved hypothetical protein [Streptomyces sp. SPB78] Length = 121 Score = 111 bits (277), Expect = 9e-30 Identities = 56/83 (67%), Positives = 58/83 (69%) Frame = -2 Query: 262 PPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKS 83 PP +RRKVG TSS H PY LG TRATM GT A S+SQK S DW LQLD MKS Sbjct: 7 PPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKS 66 Query: 82 ESLVIADQHRCGEYVPGSCTHRP 14 E LVIADQH CGEYVPG CTH P Sbjct: 67 ELLVIADQHCCGEYVPGPCTHLP 89 >CEH44546.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH53230.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH63570.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI15546.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI35907.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH45438.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54615.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH43561.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH65851.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH54713.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78145.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI07024.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEI16178.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH94276.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96255.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH96707.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH78252.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEH86582.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ25533.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ20943.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEJ48970.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEJ48846.1 conserved hypothetical protein [Xanthomonas citri pv. bilvae] CEL46622.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL39945.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL48747.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEL34945.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF35107.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF34769.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE39468.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE24906.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEE74158.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22933.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF22095.1 conserved hypothetical protein [Xanthomonas citri pv. citri] CEF21555.1 conserved hypothetical protein [Xanthomonas citri pv. citri] Length = 83 Score = 109 bits (273), Expect = 1e-29 Identities = 54/65 (83%), Positives = 56/65 (86%) Frame = -1 Query: 275 HSKGTAGDKPEEGGDDVKSSWPLRAGLHTCYNGRYRGQPTREREPIPENLS*SGLESATR 96 +SK TAGDKPEEGGDDVKSSWPLR GLHT YNGR RG TRE +PIPE LS SGLESATR Sbjct: 8 NSKETAGDKPEEGGDDVKSSWPLRPGLHTYYNGRDRGLQTREGKPIPETLSQSGLESATR 67 Query: 95 LHEVG 81 LHEVG Sbjct: 68 LHEVG 72 >AOE11689.1 hypothetical protein [uncultured bacterium] Length = 109 Score = 109 bits (273), Expect = 3e-29 Identities = 59/91 (64%), Positives = 65/91 (71%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 TL E P + RKVG TS+ HGPY LG+TRATMV TEGS + S+S K Y S D SLQLD Sbjct: 4 TLAELPAQAARKVGTTSNHHGPYILGHTRATMVVTEGSHWVTRSKSLKHYLSSDRSLQLD 63 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHHG 2 +K ESLVIA Q GEYVPG CTHRPS HG Sbjct: 64 FVKLESLVIAHQPWRGEYVPGPCTHRPSSHG 94 >CEE39501.1 conserved hypothetical protein [Xanthomonas citri pv. citri] Length = 83 Score = 108 bits (269), Expect = 5e-29 Identities = 53/65 (81%), Positives = 56/65 (86%) Frame = -1 Query: 275 HSKGTAGDKPEEGGDDVKSSWPLRAGLHTCYNGRYRGQPTREREPIPENLS*SGLESATR 96 +SK TAGDKPEEGGD+VKSSWPLR GLHT YNGR RG TRE +PIPE LS SGLESATR Sbjct: 8 NSKETAGDKPEEGGDEVKSSWPLRPGLHTYYNGRDRGLQTREGKPIPETLSQSGLESATR 67 Query: 95 LHEVG 81 LHEVG Sbjct: 68 LHEVG 72 >KMS64610.1 hypothetical protein BVRB_018500 [Beta vulgaris subsp. vulgaris] Length = 108 Score = 108 bits (269), Expect = 1e-28 Identities = 51/76 (67%), Positives = 55/76 (72%) Frame = -2 Query: 232 MTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSESLVIADQHR 53 MTSS H PY G+T ATM GT+ GS+S+K S DW LQLD MKSESLVIADQ R Sbjct: 1 MTSSHHAPYVQGFTHATMAGTDRCDPVRGSESEKAGLSSDWGLQLDPMKSESLVIADQQR 60 Query: 52 CGEYVPGSCTHRPSHH 5 CGEYVPG CTHRPS H Sbjct: 61 CGEYVPGPCTHRPSRH 76 >SIG42355.1 Uncharacterised protein [Mycobacterium abscessus subsp. abscessus] Length = 79 Score = 106 bits (265), Expect = 2e-28 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = -2 Query: 232 MTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSESLVIADQHR 53 MTSS H PY G+T ATM TEG + S+S K S DW LQLD MKSESLVIADQ R Sbjct: 1 MTSSHHAPYVQGFTHATMASTEGCEAVRWSESLKAGLSSDWGLQLDPMKSESLVIADQQR 60 Query: 52 CGEYVPGSCTHRPSHH 5 CGEYVPG CTHRPS H Sbjct: 61 CGEYVPGPCTHRPSRH 76 >JAN31957.1 hypothetical protein [Daphnia magna] Length = 96 Score = 105 bits (263), Expect = 6e-28 Identities = 54/76 (71%), Positives = 57/76 (75%) Frame = -2 Query: 259 PVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSE 80 PV +RRKVGMTSSPHGPY GYTR TM GTEG Q A GSQS K RSPD SLQLDC+KSE Sbjct: 4 PVTNRRKVGMTSSPHGPYRWGYTRHTMAGTEGCQPARGSQSHKASRSPDRSLQLDCVKSE 63 Query: 79 SLVIADQHRCGEYVPG 32 SLVI DQ+ PG Sbjct: 64 SLVIVDQNVTVNTFPG 79 >KMS94002.1 hypothetical protein BVRB_025780, partial [Beta vulgaris subsp. vulgaris] Length = 124 Score = 106 bits (265), Expect = 7e-28 Identities = 57/90 (63%), Positives = 61/90 (67%) Frame = -2 Query: 274 TLKEPPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLD 95 TL + KVGMTSS GPY LG TRATM+GTEG A S+S KT S D SLQLD Sbjct: 17 TLGRQTLFEGGKVGMTSSQDGPYGLGCTRATMLGTEGRNTARWSKSSKTEPSSDCSLQLD 76 Query: 94 CMKSESLVIADQHRCGEYVPGSCTHRPSHH 5 CMK ESLV+A Q R EYVPG CTHRPS H Sbjct: 77 CMKPESLVMAYQLRRREYVPGPCTHRPSRH 106 >EFE84355.1 conserved hypothetical protein, partial [Streptomyces albus J1074] Length = 87 Score = 103 bits (257), Expect = 4e-27 Identities = 53/77 (68%), Positives = 55/77 (71%) Frame = -2 Query: 262 PPVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKS 83 PP +RRKVG TSS H PY LG TRATM GT A S+SQK S DW LQLD MKS Sbjct: 11 PPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKS 70 Query: 82 ESLVIADQHRCGEYVPG 32 ESLVIADQH CGEYVPG Sbjct: 71 ESLVIADQHCCGEYVPG 87 >CKG78254.1 Uncharacterised protein [Corynebacterium diphtheriae] CKG91802.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH11103.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH18086.1 Uncharacterised protein [Corynebacterium diphtheriae] CKH22304.1 Uncharacterised protein [Corynebacterium diphtheriae] Length = 79 Score = 103 bits (256), Expect = 4e-27 Identities = 50/76 (65%), Positives = 54/76 (71%) Frame = -2 Query: 232 MTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSESLVIADQHR 53 MTS+ H PY G+T ATMVGT + S+S K S DW LQLD MKSESLVIADQ R Sbjct: 1 MTSNHHAPYVQGFTHATMVGTTRCEPVRVSESLKAGLSSDWGLQLDPMKSESLVIADQQR 60 Query: 52 CGEYVPGSCTHRPSHH 5 CGEYVPG CTHRPS H Sbjct: 61 CGEYVPGPCTHRPSRH 76 >JAN84548.1 hypothetical protein [Daphnia magna] Length = 96 Score = 102 bits (255), Expect = 1e-26 Identities = 53/76 (69%), Positives = 57/76 (75%) Frame = -2 Query: 259 PVISRRKVGMTSSPHGPYALGYTRATMVGTEGSQRASGSQSQKTYRSPDWSLQLDCMKSE 80 PV +RRKVGMTSS HGPY GYTR TM GTEG Q A GSQS K RSPD SLQLDC+KSE Sbjct: 4 PVTNRRKVGMTSSHHGPYVRGYTRHTMAGTEGCQPARGSQSHKASRSPDRSLQLDCVKSE 63 Query: 79 SLVIADQHRCGEYVPG 32 SLVIA+Q+ PG Sbjct: 64 SLVIANQNVAVNTFPG 79