BLASTX nr result
ID: Glycyrrhiza28_contig00007246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007246 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75182.1 Glycine-rich RNA-binding protein GRP1A [Cajanus cajan] 54 4e-07 KRH51529.1 hypothetical protein GLYMA_06G012600 [Glycine max] 54 6e-07 KRH51527.1 hypothetical protein GLYMA_06G012600 [Glycine max] 54 8e-07 XP_015932759.1 PREDICTED: glycine-rich RNA-binding protein-like ... 54 9e-07 XP_003527212.1 PREDICTED: glycine-rich RNA-binding protein 2 [Gl... 54 9e-07 XP_016166310.1 PREDICTED: glycine-rich RNA-binding, abscisic aci... 54 9e-07 XP_017420768.1 PREDICTED: glycine-rich RNA-binding protein-like ... 54 9e-07 XP_007136168.1 hypothetical protein PHAVU_009G023700g [Phaseolus... 54 9e-07 XP_014499790.1 PREDICTED: glycine-rich RNA-binding protein GRP1A... 54 9e-07 KYP66079.1 Glycine-rich RNA-binding protein GRP2A [Cajanus cajan] 52 2e-06 GAU45385.1 hypothetical protein TSUD_90050 [Trifolium subterraneum] 52 2e-06 XP_015698376.1 PREDICTED: glycine-rich RNA-binding protein GRP1A... 50 3e-06 XP_014518502.1 PREDICTED: glycine-rich RNA-binding, abscisic aci... 52 3e-06 XP_017431478.1 PREDICTED: glycine-rich RNA-binding protein GRP1A... 52 3e-06 ONH97238.1 hypothetical protein PRUPE_7G178900, partial [Prunus ... 50 3e-06 XP_009921627.1 PREDICTED: glycine-rich RNA-binding protein GRP1A... 50 3e-06 XP_020091699.1 glycine-rich RNA-binding protein GRP1A-like [Anan... 51 3e-06 ONK74508.1 uncharacterized protein A4U43_C03F7090 [Asparagus off... 50 3e-06 OAY80993.1 Glycine-rich RNA-binding protein GRP1A [Ananas comosus] 51 5e-06 ABG22105.1 Glycine-rich RNA-binding protein GRP1A, putative, exp... 50 5e-06 >KYP75182.1 Glycine-rich RNA-binding protein GRP1A [Cajanus cajan] Length = 132 Score = 53.5 bits (127), Expect = 4e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >KRH51529.1 hypothetical protein GLYMA_06G012600 [Glycine max] Length = 154 Score = 53.5 bits (127), Expect = 6e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 11 VINDRETGRSRGFGFVTFATEQAMR 35 >KRH51527.1 hypothetical protein GLYMA_06G012600 [Glycine max] Length = 170 Score = 53.5 bits (127), Expect = 8e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_015932759.1 PREDICTED: glycine-rich RNA-binding protein-like [Arachis duranensis] Length = 181 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_003527212.1 PREDICTED: glycine-rich RNA-binding protein 2 [Glycine max] KRH51528.1 hypothetical protein GLYMA_06G012600 [Glycine max] Length = 182 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_016166310.1 PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible protein-like [Arachis ipaensis] Length = 184 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_017420768.1 PREDICTED: glycine-rich RNA-binding protein-like [Vigna angularis] KOM42338.1 hypothetical protein LR48_Vigan04g253600 [Vigna angularis] BAT77486.1 hypothetical protein VIGAN_02006500 [Vigna angularis var. angularis] Length = 184 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_007136168.1 hypothetical protein PHAVU_009G023700g [Phaseolus vulgaris] ESW08162.1 hypothetical protein PHAVU_009G023700g [Phaseolus vulgaris] Length = 185 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >XP_014499790.1 PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Vigna radiata var. radiata] Length = 187 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAMR Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMR 63 >KYP66079.1 Glycine-rich RNA-binding protein GRP2A [Cajanus cajan] Length = 164 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 VINDRETGRSRGFGFVTFATEQAM+ Sbjct: 39 VINDRETGRSRGFGFVTFATEQAMK 63 >GAU45385.1 hypothetical protein TSUD_90050 [Trifolium subterraneum] Length = 159 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTFATEQ+MR Sbjct: 39 IINDRETGRSRGFGFVTFATEQSMR 63 >XP_015698376.1 PREDICTED: glycine-rich RNA-binding protein GRP1A-like, partial [Oryza brachyantha] Length = 80 Score = 50.1 bits (118), Expect = 3e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTF+ EQAMR Sbjct: 39 IINDRETGRSRGFGFVTFSNEQAMR 63 >XP_014518502.1 PREDICTED: glycine-rich RNA-binding, abscisic acid-inducible protein [Vigna radiata var. radiata] Length = 176 Score = 52.0 bits (123), Expect = 3e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTF+TEQAMR Sbjct: 39 IINDRETGRSRGFGFVTFSTEQAMR 63 >XP_017431478.1 PREDICTED: glycine-rich RNA-binding protein GRP1A-like [Vigna angularis] KOM50898.1 hypothetical protein LR48_Vigan08g172500 [Vigna angularis] BAT90929.1 hypothetical protein VIGAN_06222600 [Vigna angularis var. angularis] Length = 177 Score = 52.0 bits (123), Expect = 3e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTF+TEQAMR Sbjct: 39 IINDRETGRSRGFGFVTFSTEQAMR 63 >ONH97238.1 hypothetical protein PRUPE_7G178900, partial [Prunus persica] Length = 68 Score = 49.7 bits (117), Expect = 3e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -2 Query: 80 SVINDRETGRSRGFGFVTFATEQAMR 3 S+INDRETGRSRGFGFVTF+ E AMR Sbjct: 30 SIINDRETGRSRGFGFVTFSNENAMR 55 >XP_009921627.1 PREDICTED: glycine-rich RNA-binding protein GRP1A-like, partial [Haliaeetus albicilla] Length = 68 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -2 Query: 101 SFINHTKS-VINDRETGRSRGFGFVTFATEQAMR 3 +F N T+S +INDRETGRSRGFGFVTFA E++MR Sbjct: 30 AFGNVTESKIINDRETGRSRGFGFVTFADEKSMR 63 >XP_020091699.1 glycine-rich RNA-binding protein GRP1A-like [Ananas comosus] Length = 136 Score = 51.2 bits (121), Expect = 3e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTFA EQAMR Sbjct: 39 IINDRETGRSRGFGFVTFANEQAMR 63 >ONK74508.1 uncharacterized protein A4U43_C03F7090 [Asparagus officinalis] Length = 86 Score = 50.1 bits (118), Expect = 3e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTF+ EQAMR Sbjct: 7 IINDRETGRSRGFGFVTFSNEQAMR 31 >OAY80993.1 Glycine-rich RNA-binding protein GRP1A [Ananas comosus] Length = 156 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTFA EQAMR Sbjct: 39 IINDRETGRSRGFGFVTFANEQAMR 63 >ABG22105.1 Glycine-rich RNA-binding protein GRP1A, putative, expressed [Oryza sativa Japonica Group] Length = 117 Score = 50.4 bits (119), Expect = 5e-06 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = -2 Query: 77 VINDRETGRSRGFGFVTFATEQAMR 3 +INDRETGRSRGFGFVTF++EQAMR Sbjct: 39 IINDRETGRSRGFGFVTFSSEQAMR 63