BLASTX nr result
ID: Glycyrrhiza28_contig00007097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007097 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014489713.1 PREDICTED: two-component response regulator ARR9 ... 61 7e-09 KRG95134.1 hypothetical protein GLYMA_19G132300 [Glycine max] 61 8e-09 XP_006603749.1 PREDICTED: uncharacterized protein LOC100814494 i... 61 8e-09 NP_001241095.1 uncharacterized protein LOC100814494 [Glycine max... 61 1e-08 KRG95133.1 hypothetical protein GLYMA_19G132300 [Glycine max] 61 1e-08 KHN14915.1 Two-component response regulator ARR9 [Glycine soja] 61 1e-08 XP_017416975.1 PREDICTED: two-component response regulator ARR9 ... 60 1e-08 XP_007162123.1 hypothetical protein PHAVU_001G125800g [Phaseolus... 59 5e-08 NP_001240226.1 uncharacterized protein LOC100788079 [Glycine max... 58 1e-07 GAU17910.1 hypothetical protein TSUD_330350 [Trifolium subterran... 55 1e-06 KYP46335.1 Two-component response regulator ARR9 [Cajanus cajan] 54 2e-06 >XP_014489713.1 PREDICTED: two-component response regulator ARR9 [Vigna radiata var. radiata] Length = 243 Score = 61.2 bits (147), Expect = 7e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 204 EQQQQSLQQ---ANNNKRKTMEQGLSPETDRTRPRYSGIAT 241 >KRG95134.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 214 Score = 60.8 bits (146), Expect = 8e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 174 EQQQQSLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 212 >XP_006603749.1 PREDICTED: uncharacterized protein LOC100814494 isoform X1 [Glycine max] KRG95132.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 220 Score = 60.8 bits (146), Expect = 8e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 180 EQQQQSLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 218 >NP_001241095.1 uncharacterized protein LOC100814494 [Glycine max] ACU24338.1 unknown [Glycine max] Length = 244 Score = 60.8 bits (146), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 204 EQQQQSLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 242 >KRG95133.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 246 Score = 60.8 bits (146), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 206 EQQQQSLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 244 >KHN14915.1 Two-component response regulator ARR9 [Glycine soja] Length = 246 Score = 60.8 bits (146), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 206 EQQQQSLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 244 >XP_017416975.1 PREDICTED: two-component response regulator ARR9 [Vigna angularis] KOM38705.1 hypothetical protein LR48_Vigan03g208700 [Vigna angularis] BAT85155.1 hypothetical protein VIGAN_04266000 [Vigna angularis var. angularis] Length = 243 Score = 60.5 bits (145), Expect = 1e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+QSLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 203 EQQQQSLQQAN--NNNKRKTMEQGLSPETDRTRPRYSGIAT 241 >XP_007162123.1 hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris] ESW34117.1 hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris] Length = 241 Score = 58.9 bits (141), Expect = 5e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+ SLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 202 EQQQPSLQQ---ANNNKRKTMEQGLSPETDRTRPRYSGIAT 239 >NP_001240226.1 uncharacterized protein LOC100788079 [Glycine max] ACU21117.1 unknown [Glycine max] KHN30383.1 Two-component response regulator ARR9 [Glycine soja] KRH66808.1 hypothetical protein GLYMA_03G130000 [Glycine max] Length = 248 Score = 58.2 bits (139), Expect = 1e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQQ+Q LQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 208 EQQQQILQQAN--NNNKRKTMEQGLSPETDRTRPRYSGIAT 246 >GAU17910.1 hypothetical protein TSUD_330350 [Trifolium subterraneum] Length = 201 Score = 54.7 bits (130), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 +QQ+QSLQQ N+ KRK ME GLS ETDRTRPRYSG+ T Sbjct: 162 DQQQQSLQQG---NNNKRKNMEQGLSSETDRTRPRYSGIAT 199 >KYP46335.1 Two-component response regulator ARR9 [Cajanus cajan] Length = 237 Score = 54.3 bits (129), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 352 EQQRQSLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 230 EQ +QSLQQ + KRKT+E GLSPETDRTRPRYSG+ T Sbjct: 199 EQPQQSLQQA----NNKRKTIEQGLSPETDRTRPRYSGIAT 235