BLASTX nr result
ID: Glycyrrhiza28_contig00007078
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00007078 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EDS75288.1 hypothetical protein CLOSPI_01140 [ [[Clostridium] sp... 76 1e-16 KTD06091.1 hypothetical protein Lgra_2868 [Legionella gratiana] ... 75 1e-16 WP_064101330.1 hypothetical protein [Legionella oakridgensis] 74 5e-16 WP_051720908.1 hypothetical protein [Legionella pneumophila] 74 5e-16 KTD43805.1 hypothetical protein Loak_0355 [Legionella oakridgensis] 74 6e-16 KTC66577.1 hypothetical protein Lade_1235 [Legionella adelaidens... 74 6e-16 CCD04474.1 conserved protein of unknown function [Legionella pne... 74 6e-16 EFF91373.1 cell wall-associated hydrolase [Streptomyces sp. e14] 74 1e-15 EDY53870.1 cell wall-associated hydrolase [Streptomyces sviceus ... 74 1e-15 EDX22399.1 conserved hypothetical protein [Streptomyces sp. Mg1] 74 1e-15 KTD17650.1 hypothetical protein Ljor_1956 [Legionella jordanis] 72 2e-15 KTC97695.1 hypothetical protein Lery_1534 [Legionella erythra] K... 72 2e-15 KTD65294.1 hypothetical protein Lspi_0754 [Legionella spiritensis] 72 3e-15 KTD22074.1 hypothetical protein Llan_1337 [Legionella lansingensis] 72 3e-15 KTC99073.1 hypothetical protein Lgee_1339 [Legionella geestiana] 72 3e-15 KRG20638.1 hypothetical protein HT99x_02372 [Candidatus Berkiell... 73 4e-15 WP_039903486.1 hypothetical protein [[Clostridium] spiroforme] 71 9e-15 EES90516.1 conserved hypothetical protein [Clostridium botulinum... 71 9e-15 KMV78109.1 hypothetical protein HMPREF0979_01147 [Coprobacillus ... 71 1e-14 ADI18870.1 hypothetical protein [uncultured Pseudomonadales bact... 70 1e-14 >EDS75288.1 hypothetical protein CLOSPI_01140 [ [[Clostridium] spiroforme DSM 1552] Length = 100 Score = 76.3 bits (186), Expect = 1e-16 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 206 GRSACYPRSTFYLLSDGLSIQHRRITKADFRPCSSDRSRSQAPLYFC 66 GRSACYP+ +FY LSDGLSIQHRRITK DFRPCS+ SRSQ P C Sbjct: 12 GRSACYPQGSFYPLSDGLSIQHRRITKPDFRPCSTCWSRSQTPFCLC 58 >KTD06091.1 hypothetical protein Lgra_2868 [Legionella gratiana] KTD66497.1 hypothetical protein Lsan_0442 [Legionella santicrucis] KTD78130.1 hypothetical protein Lstg_1411 [Legionella steigerwaltii] Length = 75 Score = 75.5 bits (184), Expect = 1e-16 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTARA ARAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARATARAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >WP_064101330.1 hypothetical protein [Legionella oakridgensis] Length = 71 Score = 73.9 bits (180), Expect = 5e-16 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTARA ARAGTKVG SDP VL G+A+AQ+IKGTPGITG Sbjct: 27 SVKAKGCLTARATARAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 71 >WP_051720908.1 hypothetical protein [Legionella pneumophila] Length = 71 Score = 73.9 bits (180), Expect = 5e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR ARAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 27 SVKAKGCLTARVTARAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 71 >KTD43805.1 hypothetical protein Loak_0355 [Legionella oakridgensis] Length = 75 Score = 73.9 bits (180), Expect = 6e-16 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTARA ARAGTKVG SDP VL G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARATARAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 75 >KTC66577.1 hypothetical protein Lade_1235 [Legionella adelaidensis] KTC78204.1 hypothetical protein Lbru_2496 [Legionella brunensis] KTD08135.1 hypothetical protein Ljam_2330 [Legionella jamestowniensis] KTD09915.1 hypothetical protein Lhac_2283 [Legionella hackeliae] KTD23274.1 hypothetical protein Llon_0159 [Legionella londiniensis] Length = 75 Score = 73.9 bits (180), Expect = 6e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR ARAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARVTARAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >CCD04474.1 conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD06970.1 conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD07635.1 conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD07892.1 conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] CCD10127.1 conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] ERI46377.1 hypothetical protein N749_17530 [Legionella pneumophila str. Leg01/20] KTC87314.1 hypothetical protein Ldro_0933 [Legionella drozanskii LLAP-1] KTD27115.1 hypothetical protein Lmac_1363 [Legionella maceachernii] KTD27397.1 hypothetical protein Lmic_2332 [Tatlockia micdadei] KTD33298.1 hypothetical protein Lnau_2946 [Legionella nautarum] CZI82476.1 Uncharacterised protein [Legionella pneumophila] CZG64473.1 Uncharacterised protein [Legionella pneumophila] CZG79363.1 Uncharacterised protein [Legionella pneumophila] CZJ39001.1 Uncharacterised protein [Legionella pneumophila] CZH20010.1 Uncharacterised protein [Legionella pneumophila] CZH15590.1 Uncharacterised protein [Legionella pneumophila] CZG97187.1 Uncharacterised protein [Legionella pneumophila] CZJ15659.1 Uncharacterised protein [Legionella pneumophila] CZI53033.1 Uncharacterised protein [Legionella pneumophila] CZL93354.1 Uncharacterised protein [Legionella pneumophila] CZI42588.1 Uncharacterised protein [Legionella pneumophila] CZK41167.1 Uncharacterised protein [Legionella pneumophila] CZH84400.1 Uncharacterised protein [Legionella pneumophila] CZI52244.1 Uncharacterised protein [Legionella pneumophila] CZH15521.1 Uncharacterised protein [Legionella pneumophila] CZM24583.1 Uncharacterised protein [Legionella pneumophila] CZM24115.1 Uncharacterised protein [Legionella pneumophila] CZH59483.1 Uncharacterised protein [Legionella pneumophila] CZK69433.1 Uncharacterised protein [Legionella pneumophila] CZH39727.1 Uncharacterised protein [Legionella pneumophila] CZI98514.1 Uncharacterised protein [Legionella pneumophila] CZL46981.1 Uncharacterised protein [Legionella pneumophila] CZK19248.1 Uncharacterised protein [Legionella pneumophila] CZM24347.1 Uncharacterised protein [Legionella pneumophila] CZK75722.1 Uncharacterised protein [Legionella pneumophila] CZK80737.1 Uncharacterised protein [Legionella pneumophila] CZI92548.1 Uncharacterised protein [Legionella pneumophila] CZL92297.1 Uncharacterised protein [Legionella pneumophila] CZL36456.1 Uncharacterised protein [Legionella pneumophila] CZM26244.1 Uncharacterised protein [Legionella pneumophila] CZK80133.1 Uncharacterised protein [Legionella pneumophila] CZK02364.1 Uncharacterised protein [Legionella pneumophila] CZJ44572.1 Uncharacterised protein [Legionella pneumophila] CZM44609.1 Uncharacterised protein [Legionella pneumophila] CZK26649.1 Uncharacterised protein [Legionella pneumophila] CZM17964.1 Uncharacterised protein [Legionella pneumophila] CZJ93615.1 Uncharacterised protein [Legionella pneumophila] CZJ33813.1 Uncharacterised protein [Legionella pneumophila] CZM72532.1 Uncharacterised protein [Legionella pneumophila] CZK52840.1 Uncharacterised protein [Legionella pneumophila] CZJ13586.1 Uncharacterised protein [Legionella pneumophila] CZK34128.1 Uncharacterised protein [Legionella pneumophila] CZK17446.1 Uncharacterised protein [Legionella pneumophila] CZK63042.1 Uncharacterised protein [Legionella pneumophila] CZL71650.1 Uncharacterised protein [Legionella pneumophila] CZH46416.1 Uncharacterised protein [Legionella pneumophila] CZL30161.1 Uncharacterised protein [Legionella pneumophila] CZL79002.1 Uncharacterised protein [Legionella pneumophila] CZL80265.1 Uncharacterised protein [Legionella pneumophila] CZK46856.1 Uncharacterised protein [Legionella pneumophila] CZM01276.1 Uncharacterised protein [Legionella pneumophila] CZL22546.1 Uncharacterised protein [Legionella pneumophila] CZM16749.1 Uncharacterised protein [Legionella pneumophila] CZM31469.1 Uncharacterised protein [Legionella pneumophila] CZL23219.1 Uncharacterised protein [Legionella pneumophila] CZJ48883.1 Uncharacterised protein [Legionella pneumophila] CZL73924.1 Uncharacterised protein [Legionella pneumophila] CZL31969.1 Uncharacterised protein [Legionella pneumophila] CZK06185.1 Uncharacterised protein [Legionella pneumophila] CZK59011.1 Uncharacterised protein [Legionella pneumophila] CZM74693.1 Uncharacterised protein [Legionella pneumophila] CZK96224.1 Uncharacterised protein [Legionella pneumophila] CZK83073.1 Uncharacterised protein [Legionella pneumophila] CZM96431.1 Uncharacterised protein [Legionella pneumophila] CZL02871.1 Uncharacterised protein [Legionella pneumophila] CZK80353.1 Uncharacterised protein [Legionella pneumophila] CZJ61895.1 Uncharacterised protein [Legionella pneumophila] CZL98905.1 Uncharacterised protein [Legionella pneumophila] CZJ29423.1 Uncharacterised protein [Legionella pneumophila] CZK93863.1 Uncharacterised protein [Legionella pneumophila] CZL62971.1 Uncharacterised protein [Legionella pneumophila] CZK02773.1 Uncharacterised protein [Legionella pneumophila] CZI51264.1 Uncharacterised protein [Legionella pneumophila] CZK18913.1 Uncharacterised protein [Legionella pneumophila] CZG69744.1 Uncharacterised protein [Legionella pneumophila] CZI97441.1 Uncharacterised protein [Legionella pneumophila] CZL68508.1 Uncharacterised protein [Legionella pneumophila] CZK08119.1 Uncharacterised protein [Legionella pneumophila] CZL87133.1 Uncharacterised protein [Legionella pneumophila] CZM49531.1 Uncharacterised protein [Legionella pneumophila] CZJ88969.1 Uncharacterised protein [Legionella pneumophila] CZM16956.1 Uncharacterised protein [Legionella pneumophila] CZK67365.1 Uncharacterised protein [Legionella pneumophila] CZK26580.1 Uncharacterised protein [Legionella pneumophila] CZH54562.1 Uncharacterised protein [Legionella pneumophila] CZJ93562.1 Uncharacterised protein [Legionella pneumophila] CZL83067.1 Uncharacterised protein [Legionella pneumophila] CZK15281.1 Uncharacterised protein [Legionella pneumophila] CZK13565.1 Uncharacterised protein [Legionella pneumophila] CZM34660.1 Uncharacterised protein [Legionella pneumophila] CZJ82182.1 Uncharacterised protein [Legionella pneumophila] CZJ63982.1 Uncharacterised protein [Legionella pneumophila] CZK02382.1 Uncharacterised protein [Legionella pneumophila] CZM96458.1 Uncharacterised protein [Legionella pneumophila] CZL37407.1 Uncharacterised protein [Legionella pneumophila] CZK21196.1 Uncharacterised protein [Legionella pneumophila] CZJ63564.1 Uncharacterised protein [Legionella pneumophila] CZK11714.1 Uncharacterised protein [Legionella pneumophila] CZK45278.1 Uncharacterised protein [Legionella pneumophila] CZG66935.1 Uncharacterised protein [Legionella pneumophila] CZK55124.1 Uncharacterised protein [Legionella pneumophila] CZL10310.1 Uncharacterised protein [Legionella pneumophila] CZK57732.1 Uncharacterised protein [Legionella pneumophila] CZL22928.1 Uncharacterised protein [Legionella pneumophila] CZM11678.1 Uncharacterised protein [Legionella pneumophila] CZH58799.1 Uncharacterised protein [Legionella pneumophila] CZG55076.1 Uncharacterised protein [Legionella pneumophila] CZM07454.1 Uncharacterised protein [Legionella pneumophila] CZH92925.1 Uncharacterised protein [Legionella pneumophila] CZH82809.1 Uncharacterised protein [Legionella pneumophila] CZL64203.1 Uncharacterised protein [Legionella pneumophila] CZM14357.1 Uncharacterised protein [Legionella pneumophila] CZK85910.1 Uncharacterised protein [Legionella pneumophila] CZH06343.1 Uncharacterised protein [Legionella pneumophila] CZG70034.1 Uncharacterised protein [Legionella pneumophila] CZL34921.1 Uncharacterised protein [Legionella pneumophila] CZH07513.1 Uncharacterised protein [Legionella pneumophila] CZM10793.1 Uncharacterised protein [Legionella pneumophila] CZK83962.1 Uncharacterised protein [Legionella pneumophila] CZL01374.1 Uncharacterised protein [Legionella pneumophila] CZM31584.1 Uncharacterised protein [Legionella pneumophila] CZL25290.1 Uncharacterised protein [Legionella pneumophila] CZL80389.1 Uncharacterised protein [Legionella pneumophila] CZH60322.1 Uncharacterised protein [Legionella pneumophila] CZM62993.1 Uncharacterised protein [Legionella pneumophila] CZI50544.1 Uncharacterised protein [Legionella pneumophila] CZJ50709.1 Uncharacterised protein [Legionella pneumophila] CZM42488.1 Uncharacterised protein [Legionella pneumophila] CZH21583.1 Uncharacterised protein [Legionella pneumophila] CZI56503.1 Uncharacterised protein [Legionella pneumophila] CZH67291.1 Uncharacterised protein [Legionella pneumophila] CZL65663.1 Uncharacterised protein [Legionella pneumophila] CZJ49406.1 Uncharacterised protein [Legionella pneumophila] CZG31403.1 Uncharacterised protein [Legionella pneumophila] CZP95349.1 Uncharacterised protein [Legionella pneumophila] CZI80307.1 Uncharacterised protein [Legionella pneumophila] CZI92492.1 Uncharacterised protein [Legionella pneumophila] CZJ39416.1 Uncharacterised protein [Legionella pneumophila] CZP11738.1 Uncharacterised protein [Legionella pneumophila] CZH24167.1 Uncharacterised protein [Legionella pneumophila] CZJ34981.1 Uncharacterised protein [Legionella pneumophila] CZP61549.1 Uncharacterised protein [Legionella pneumophila] CZL38490.1 Uncharacterised protein [Legionella pneumophila] CZG48874.1 Uncharacterised protein [Legionella pneumophila] CZI67844.1 Uncharacterised protein [Legionella pneumophila] CZM38166.1 Uncharacterised protein [Legionella pneumophila] CZJ27594.1 Uncharacterised protein [Legionella pneumophila] CZG27293.1 Uncharacterised protein [Legionella pneumophila] CZP35533.1 Uncharacterised protein [Legionella pneumophila] CZJ29893.1 Uncharacterised protein [Legionella pneumophila] CZP56701.1 Uncharacterised protein [Legionella pneumophila] CZH24490.1 Uncharacterised protein [Legionella pneumophila] CZI21320.1 Uncharacterised protein [Legionella pneumophila] CZH75053.1 Uncharacterised protein [Legionella pneumophila] CZH46671.1 Uncharacterised protein [Legionella pneumophila] CZH25377.1 Uncharacterised protein [Legionella pneumophila] CZH61610.1 Uncharacterised protein [Legionella pneumophila] CZQ06699.1 Uncharacterised protein [Legionella pneumophila] CZP48183.1 Uncharacterised protein [Legionella pneumophila] CZH63514.1 Uncharacterised protein [Legionella pneumophila] CZP05957.1 Uncharacterised protein [Legionella pneumophila] CZO27771.1 Uncharacterised protein [Legionella pneumophila] CZP56522.1 Uncharacterised protein [Legionella pneumophila] CZH60160.1 Uncharacterised protein [Legionella pneumophila] CZP34347.1 Uncharacterised protein [Legionella pneumophila] CZP17935.1 Uncharacterised protein [Legionella pneumophila] CZP60742.1 Uncharacterised protein [Legionella pneumophila] CZJ21078.1 Uncharacterised protein [Legionella pneumophila] CZP30969.1 Uncharacterised protein [Legionella pneumophila] CZI94712.1 Uncharacterised protein [Legionella pneumophila] CZP79766.1 Uncharacterised protein [Legionella pneumophila] CZP49397.1 Uncharacterised protein [Legionella pneumophila] CZI48250.1 Uncharacterised protein [Legionella pneumophila] CZH69357.1 Uncharacterised protein [Legionella pneumophila] CZP25368.1 Uncharacterised protein [Legionella pneumophila] CZJ34888.1 Uncharacterised protein [Legionella pneumophila] CZI66811.1 Uncharacterised protein [Legionella pneumophila] CZP64175.1 Uncharacterised protein [Legionella pneumophila] CZI50769.1 Uncharacterised protein [Legionella pneumophila] CZH66896.1 Uncharacterised protein [Legionella pneumophila] CZG74829.1 Uncharacterised protein [Legionella pneumophila] CZH26891.1 Uncharacterised protein [Legionella pneumophila] CZL23400.1 Uncharacterised protein [Legionella pneumophila] CZP34284.1 Uncharacterised protein [Legionella pneumophila] CZH41714.1 Uncharacterised protein [Legionella pneumophila] CZP85137.1 Uncharacterised protein [Legionella pneumophila] CZP62330.1 Uncharacterised protein [Legionella pneumophila] CZH24590.1 Uncharacterised protein [Legionella pneumophila] CZP56915.1 Uncharacterised protein [Legionella pneumophila] CZP68938.1 Uncharacterised protein [Legionella pneumophila] CZH95933.1 Uncharacterised protein [Legionella pneumophila] CZP57529.1 Uncharacterised protein [Legionella pneumophila] CZP75546.1 Uncharacterised protein [Legionella pneumophila] CZP78457.1 Uncharacterised protein [Legionella pneumophila] CZF99198.1 Uncharacterised protein [Legionella pneumophila] CZJ66915.1 Uncharacterised protein [Legionella pneumophila] CZH73999.1 Uncharacterised protein [Legionella pneumophila] CZJ32649.1 Uncharacterised protein [Legionella pneumophila] CZG15562.1 Uncharacterised protein [Legionella pneumophila] CZI16165.1 Uncharacterised protein [Legionella pneumophila] CZP97621.1 Uncharacterised protein [Legionella pneumophila] CZG11648.1 Uncharacterised protein [Legionella pneumophila] CZQ00554.1 Uncharacterised protein [Legionella pneumophila] CZP43033.1 Uncharacterised protein [Legionella pneumophila] CZG48846.1 Uncharacterised protein [Legionella pneumophila] CZH67935.1 Uncharacterised protein [Legionella pneumophila] CZG31571.1 Uncharacterised protein [Legionella pneumophila] CZG20672.1 Uncharacterised protein [Legionella pneumophila] CZG47687.1 Uncharacterised protein [Legionella pneumophila] CZH41746.1 Uncharacterised protein [Legionella pneumophila] CZH27845.1 Uncharacterised protein [Legionella pneumophila] CZG24917.1 Uncharacterised protein [Legionella pneumophila] CZF98708.1 Uncharacterised protein [Legionella pneumophila] CZH69526.1 Uncharacterised protein [Legionella pneumophila] CZG85852.1 Uncharacterised protein [Legionella pneumophila] CZK38271.1 Uncharacterised protein [Legionella pneumophila] CZH52980.1 Uncharacterised protein [Legionella pneumophila] CZH08268.1 Uncharacterised protein [Legionella pneumophila] CZP34726.1 Uncharacterised protein [Legionella pneumophila] CZI92622.1 Uncharacterised protein [Legionella pneumophila] CZJ95724.1 Uncharacterised protein [Legionella pneumophila] CZH58000.1 Uncharacterised protein [Legionella pneumophila] CZN63253.1 Uncharacterised protein [Legionella pneumophila] CZO02815.1 Uncharacterised protein [Legionella pneumophila] CZH14487.1 Uncharacterised protein [Legionella pneumophila] CZM59781.1 Uncharacterised protein [Legionella pneumophila] CZN20251.1 Uncharacterised protein [Legionella pneumophila] CZM58160.1 Uncharacterised protein [Legionella pneumophila] CZN91588.1 Uncharacterised protein [Legionella pneumophila] CZL99015.1 Uncharacterised protein [Legionella pneumophila] CZO94010.1 Uncharacterised protein [Legionella pneumophila] CZM38199.1 Uncharacterised protein [Legionella pneumophila] CZI04703.1 Uncharacterised protein [Legionella pneumophila] CZN61285.1 Uncharacterised protein [Legionella pneumophila] CZP25934.1 Uncharacterised protein [Legionella pneumophila] CZO05389.1 Uncharacterised protein [Legionella pneumophila] CZH68145.1 Uncharacterised protein [Legionella pneumophila] CZO06755.1 Uncharacterised protein [Legionella pneumophila] CZM89611.1 Uncharacterised protein [Legionella pneumophila] CZN60243.1 Uncharacterised protein [Legionella pneumophila] CZP14453.1 Uncharacterised protein [Legionella pneumophila] CZI66176.1 Uncharacterised protein [Legionella pneumophila] CZJ39883.1 Uncharacterised protein [Legionella pneumophila] CZP50727.1 Uncharacterised protein [Legionella pneumophila] CZO25372.1 Uncharacterised protein [Legionella pneumophila] CZM48430.1 Uncharacterised protein [Legionella pneumophila] CZP09677.1 Uncharacterised protein [Legionella pneumophila] CZP40551.1 Uncharacterised protein [Legionella pneumophila] CZO70096.1 Uncharacterised protein [Legionella pneumophila] CZP16712.1 Uncharacterised protein [Legionella pneumophila] CZO32127.1 Uncharacterised protein [Legionella pneumophila] CZP59442.1 Uncharacterised protein [Legionella pneumophila] CZM31911.1 Uncharacterised protein [Legionella pneumophila] CZO41092.1 Uncharacterised protein [Legionella pneumophila] CZM44475.1 Uncharacterised protein [Legionella pneumophila] CZO32120.1 Uncharacterised protein [Legionella pneumophila] CZN90583.1 Uncharacterised protein [Legionella pneumophila] CZH97996.1 Uncharacterised protein [Legionella pneumophila] CZO05809.1 Uncharacterised protein [Legionella pneumophila] CZP50857.1 Uncharacterised protein [Legionella pneumophila] CZM62528.1 Uncharacterised protein [Legionella pneumophila] CZM25953.1 Uncharacterised protein [Legionella pneumophila] CZO20928.1 Uncharacterised protein [Legionella pneumophila] CZO96079.1 Uncharacterised protein [Legionella pneumophila] CZP55820.1 Uncharacterised protein [Legionella pneumophila] CZL69460.1 Uncharacterised protein [Legionella pneumophila] CZO67496.1 Uncharacterised protein [Legionella pneumophila] CZO35315.1 Uncharacterised protein [Legionella pneumophila] CZI00880.1 Uncharacterised protein [Legionella pneumophila] CZN70372.1 Uncharacterised protein [Legionella pneumophila] CZP02545.1 Uncharacterised protein [Legionella pneumophila] CZO57825.1 Uncharacterised protein [Legionella pneumophila] CZO89169.1 Uncharacterised protein [Legionella pneumophila] CZN51232.1 Uncharacterised protein [Legionella pneumophila] CZM57553.1 Uncharacterised protein [Legionella pneumophila] CZN35119.1 Uncharacterised protein [Legionella pneumophila] CZO74672.1 Uncharacterised protein [Legionella pneumophila] CZO68678.1 Uncharacterised protein [Legionella pneumophila] CZO33730.1 Uncharacterised protein [Legionella pneumophila] CZN80377.1 Uncharacterised protein [Legionella pneumophila] CZN97016.1 Uncharacterised protein [Legionella pneumophila] CZO87071.1 Uncharacterised protein [Legionella pneumophila] CZN56520.1 Uncharacterised protein [Legionella pneumophila] CZM52451.1 Uncharacterised protein [Legionella pneumophila] CZM88053.1 Uncharacterised protein [Legionella pneumophila] CZN58144.1 Uncharacterised protein [Legionella pneumophila] CZL86131.1 Uncharacterised protein [Legionella pneumophila] CZM14680.1 Uncharacterised protein [Legionella pneumophila] CZN66599.1 Uncharacterised protein [Legionella pneumophila] CZN93739.1 Uncharacterised protein [Legionella pneumophila] CZN62836.1 Uncharacterised protein [Legionella pneumophila] CZN97895.1 Uncharacterised protein [Legionella pneumophila] CZN99361.1 Uncharacterised protein [Legionella pneumophila] CZP07419.1 Uncharacterised protein [Legionella pneumophila] CZO50438.1 Uncharacterised protein [Legionella pneumophila] CZM34249.1 Uncharacterised protein [Legionella pneumophila] CZM75971.1 Uncharacterised protein [Legionella pneumophila] CZL53719.1 Uncharacterised protein [Legionella pneumophila] CZN37556.1 Uncharacterised protein [Legionella pneumophila] CZM81152.1 Uncharacterised protein [Legionella pneumophila] CZM94180.1 Uncharacterised protein [Legionella pneumophila] CZO22481.1 Uncharacterised protein [Legionella pneumophila] CZM73469.1 Uncharacterised protein [Legionella pneumophila] CZN71695.1 Uncharacterised protein [Legionella pneumophila] CZM76971.1 Uncharacterised protein [Legionella pneumophila] CZO25289.1 Uncharacterised protein [Legionella pneumophila] CZM04027.1 Uncharacterised protein [Legionella pneumophila] CZO43860.1 Uncharacterised protein [Legionella pneumophila] CZM29614.1 Uncharacterised protein [Legionella pneumophila] CZN03587.1 Uncharacterised protein [Legionella pneumophila] CZM04731.1 Uncharacterised protein [Legionella pneumophila] CZN21706.1 Uncharacterised protein [Legionella pneumophila] CZN53624.1 Uncharacterised protein [Legionella pneumophila] CZM77900.1 Uncharacterised protein [Legionella pneumophila] CZM21286.1 Uncharacterised protein [Legionella pneumophila] CZN06449.1 Uncharacterised protein [Legionella pneumophila] CZM50908.1 Uncharacterised protein [Legionella pneumophila] CZN45953.1 Uncharacterised protein [Legionella pneumophila] CZI89368.1 Uncharacterised protein [Legionella pneumophila] CZM66794.1 Uncharacterised protein [Legionella pneumophila] CZH75088.1 Uncharacterised protein [Legionella pneumophila] CZI51920.1 Uncharacterised protein [Legionella pneumophila] CZM12088.1 Uncharacterised protein [Legionella pneumophila] CZP86256.1 Uncharacterised protein [Legionella pneumophila] CZO47585.1 Uncharacterised protein [Legionella pneumophila] CZJ45507.1 Uncharacterised protein [Legionella pneumophila] CZO63803.1 Uncharacterised protein [Legionella pneumophila] CZR07154.1 Uncharacterised protein [Legionella pneumophila] CZR01942.1 Uncharacterised protein [Legionella pneumophila] CZR11795.1 Uncharacterised protein [Legionella pneumophila] CZR07613.1 Uncharacterised protein [Legionella pneumophila] CZQ79607.1 Uncharacterised protein [Legionella pneumophila] CZR11949.1 Uncharacterised protein [Legionella pneumophila] CZR28479.1 Uncharacterised protein [Legionella pneumophila] CZR27806.1 Uncharacterised protein [Legionella pneumophila] CZR32861.1 Uncharacterised protein [Legionella pneumophila] CZR18893.1 Uncharacterised protein [Legionella pneumophila] CZR18394.1 Uncharacterised protein [Legionella pneumophila] CZR16662.1 Uncharacterised protein [Legionella pneumophila] SFZ35764.1 Uncharacterised protein [Legionella pneumophila] SFZ36943.1 Uncharacterised protein [Legionella pneumophila] SFZ47449.1 Uncharacterised protein [Legionella pneumophila] SFZ35513.1 Uncharacterised protein [Legionella pneumophila] SFZ36641.1 Uncharacterised protein [Legionella pneumophila] SFZ47450.1 Uncharacterised protein [Legionella pneumophila] SFZ35461.1 Uncharacterised protein [Legionella pneumophila] SFZ36643.1 Uncharacterised protein [Legionella pneumophila] SFZ47454.1 Uncharacterised protein [Legionella pneumophila] SFZ35247.1 Uncharacterised protein [Legionella pneumophila] SFZ36646.1 Uncharacterised protein [Legionella pneumophila] SFZ47518.1 Uncharacterised protein [Legionella pneumophila] Length = 75 Score = 73.9 bits (180), Expect = 6e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR ARAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARVTARAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >EFF91373.1 cell wall-associated hydrolase [Streptomyces sp. e14] Length = 91 Score = 73.6 bits (179), Expect = 1e-15 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -1 Query: 206 GRSACYPRSTFYLLSDGLSIQHRRITKADFRPCSSDRSRSQAPL 75 GRSACYPR TFY LSDG S HRRIT DFRPCS+ RS SQAPL Sbjct: 19 GRSACYPRGTFYPLSDGASTSHRRITSPDFRPCSTRRSHSQAPL 62 >EDY53870.1 cell wall-associated hydrolase [Streptomyces sviceus ATCC 29083] Length = 91 Score = 73.6 bits (179), Expect = 1e-15 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -1 Query: 206 GRSACYPRSTFYLLSDGLSIQHRRITKADFRPCSSDRSRSQAPL 75 GRSACYPR TFY LSDG S HRRIT DFRPCS+ RS SQAPL Sbjct: 19 GRSACYPRGTFYPLSDGASTSHRRITSPDFRPCSTRRSHSQAPL 62 >EDX22399.1 conserved hypothetical protein [Streptomyces sp. Mg1] Length = 91 Score = 73.6 bits (179), Expect = 1e-15 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -1 Query: 206 GRSACYPRSTFYLLSDGLSIQHRRITKADFRPCSSDRSRSQAPL 75 GRSACYPR TFY LSDG S HRRIT DFRPCS+ RS SQAPL Sbjct: 19 GRSACYPRGTFYPLSDGASTSHRRITSPDFRPCSTRRSHSQAPL 62 >KTD17650.1 hypothetical protein Ljor_1956 [Legionella jordanis] Length = 75 Score = 72.4 bits (176), Expect = 2e-15 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR ARAGTKVG SDP VL G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARVTARAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 75 >KTC97695.1 hypothetical protein Lery_1534 [Legionella erythra] KTD45619.1 hypothetical protein Lrub_2416 [Legionella rubrilucens] KTD68559.1 hypothetical protein Lste_1717 [Legionella steelei] Length = 75 Score = 72.4 bits (176), Expect = 2e-15 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR ARAGTKVG SDP VL G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARVTARAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 75 >KTD65294.1 hypothetical protein Lspi_0754 [Legionella spiritensis] Length = 75 Score = 72.0 bits (175), Expect = 3e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR RAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARLTGRAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >KTD22074.1 hypothetical protein Llan_1337 [Legionella lansingensis] Length = 75 Score = 72.0 bits (175), Expect = 3e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR RAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARLTGRAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >KTC99073.1 hypothetical protein Lgee_1339 [Legionella geestiana] Length = 75 Score = 72.0 bits (175), Expect = 3e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 S K +GCLTAR RAGTKVG SDP VL+G+A+AQ+IKGTPGITG Sbjct: 31 SVKAKGCLTARPTGRAGTKVGLSDPVVLNGRAIAQRIKGTPGITG 75 >KRG20638.1 hypothetical protein HT99x_02372 [Candidatus Berkiella aquae] Length = 118 Score = 73.2 bits (178), Expect = 4e-15 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG*SP 206 S K +GCLTAR RAGTKVGFSDP VL G+A+AQ+IKGTPGITG P Sbjct: 31 SVKAKGCLTARLTGRAGTKVGFSDPVVLYGRAIAQRIKGTPGITGLYP 78 >WP_039903486.1 hypothetical protein [[Clostridium] spiroforme] Length = 71 Score = 70.9 bits (172), Expect = 9e-15 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 SAK +GCLTAR +RAGTKVG SDPAVL+GKAVAQ+IK T GITG Sbjct: 27 SAKAKGCLTARPTSRAGTKVGLSDPAVLNGKAVAQRIKATLGITG 71 >EES90516.1 conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 73 Score = 70.9 bits (172), Expect = 9e-15 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -1 Query: 206 GRSACYPRSTFYLLSDGLSIQHRRITKADFRPCSSDRSRSQAPLYFC 66 GRSACYPR +FY LSDG SIQ+ RITK DFRPCS+ RSQAP C Sbjct: 19 GRSACYPRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLC 65 >KMV78109.1 hypothetical protein HMPREF0979_01147 [Coprobacillus sp. 8_1_38FAA] Length = 80 Score = 70.9 bits (172), Expect = 1e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 SAK +GCLTAR +RAGTKVG SDPAVL+GKAVAQ+IK T GITG Sbjct: 36 SAKAKGCLTARPTSRAGTKVGLSDPAVLNGKAVAQRIKATLGITG 80 >ADI18870.1 hypothetical protein [uncultured Pseudomonadales bacterium HF0010_05E14] Length = 74 Score = 70.5 bits (171), Expect = 1e-14 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +3 Query: 63 SAKVQGCLTARAIARAGTKVGFSDPAVLDGKAVAQQIKGTPGITG 197 SAKV+ CLTAR +RAGTKVG SDP VL G+A+AQ+IKGTPGITG Sbjct: 30 SAKVKVCLTARLTSRAGTKVGLSDPVVLYGRAIAQRIKGTPGITG 74