BLASTX nr result
ID: Glycyrrhiza28_contig00006451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00006451 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAD66717.1 orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] 54 1e-13 NP_064093.1 orf211 gene product (mitochondrion) [Beta vulgaris s... 52 4e-13 YP_004222334.1 hypothetical protein BevumaM_p100 (mitochondrion)... 52 4e-13 >BAD66717.1 orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 169 Score = 53.9 bits (128), Expect(2) = 1e-13 Identities = 35/73 (47%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +2 Query: 56 MSKMGPDRQPTTGTSFALARLTPACLLP-----TIVNFKKDPSFHYSWNLTDLLGQSL*A 220 MSKMG DRQPTTGT FALA L P CLLP T+ + S YS Sbjct: 1 MSKMGSDRQPTTGTCFALAPLIPTCLLPTKARVTLAGTSQTFSVCYS------------T 48 Query: 221 GVSASFTFPSQSP 259 G ASFT P Q P Sbjct: 49 GAPASFTPPPQKP 61 Score = 49.3 bits (116), Expect(2) = 1e-13 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 250 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSP 348 PKSVGPTTTR NHT TNEI LSL F+ KPVSP Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSP 92 >NP_064093.1 orf211 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] BAA99486.1 orf211 (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 211 Score = 52.4 bits (124), Expect(2) = 4e-13 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +2 Query: 56 MSKMGPDRQPTTGTSFALARLTPACLLP-----TIVNFKKDPSFHYSWNLTDLLGQSL*A 220 MSKMG DRQPTTGT FALA L P CLLP T+ + S YS Sbjct: 1 MSKMGSDRQPTTGTCFALAPLIPTCLLPTKARVTLAGTSQTFSVCYS------------T 48 Query: 221 GVSASFTFPSQSP 259 G ASFT P + P Sbjct: 49 GAPASFTPPPKKP 61 Score = 49.3 bits (116), Expect(2) = 4e-13 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 250 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSP 348 PKSVGPTTTR NHT TNEI LSL F+ KPVSP Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSP 92 >YP_004222334.1 hypothetical protein BevumaM_p100 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842140.1 hypothetical protein BemaM_p096 (mitochondrion) [Beta macrocarpa] CBJ14065.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17556.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20726.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24945.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51974.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 52.4 bits (124), Expect(2) = 4e-13 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = +2 Query: 56 MSKMGPDRQPTTGTSFALARLTPACLLP-----TIVNFKKDPSFHYSWNLTDLLGQSL*A 220 MSKMG DRQPTTGT FALA L P CLLP T+ + S YS Sbjct: 1 MSKMGSDRQPTTGTCFALAPLIPTCLLPTKARVTLAGTSQTFSVCYS------------T 48 Query: 221 GVSASFTFPSQSP 259 G ASFT P + P Sbjct: 49 GAPASFTPPPKKP 61 Score = 49.3 bits (116), Expect(2) = 4e-13 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 250 PKSVGPTTTRGNHTWTNEISLSLTFWRQKPVSP 348 PKSVGPTTTR NHT TNEI LSL F+ KPVSP Sbjct: 61 PKSVGPTTTRDNHTRTNEIFLSL-FFCAKPVSP 92