BLASTX nr result
ID: Glycyrrhiza28_contig00005633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00005633 (488 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP59469.1 hypothetical protein KK1_014905 [Cajanus cajan] 63 3e-09 XP_003532340.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 62 8e-09 XP_016194774.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 62 1e-08 NP_001238387.1 uncharacterized protein LOC100527336 [Glycine max... 61 2e-08 XP_015962946.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 61 2e-08 XP_014496635.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 61 2e-08 GAU16497.1 hypothetical protein TSUD_167290 [Trifolium subterran... 61 3e-08 XP_004489113.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 60 5e-08 XP_007139148.1 hypothetical protein PHAVU_008G005400g [Phaseolus... 60 6e-08 XP_019418837.1 PREDICTED: uncharacterized protein LOC109329597 [... 59 1e-07 XP_013447445.1 60S ribosomal protein L2, related protein [Medica... 57 9e-07 XP_017408961.1 PREDICTED: 60S ribosomal protein L2, mitochondria... 57 9e-07 ACJ84815.1 unknown [Medicago truncatula] 55 4e-06 >KYP59469.1 hypothetical protein KK1_014905 [Cajanus cajan] Length = 204 Score = 63.2 bits (152), Expect = 3e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 RGEE L+VRNWKRNSDAW HRNKRKAA+SW SIA Sbjct: 170 RGEEN---LEVRNWKRNSDAWTHRNKRKAAVSWQSIA 203 >XP_003532340.1 PREDICTED: 60S ribosomal protein L2, mitochondrial-like [Glycine max] KRH46924.1 hypothetical protein GLYMA_08G365200 [Glycine max] Length = 204 Score = 62.0 bits (149), Expect = 8e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 RGEE L+VR+W+RNSDAWAHRNKRKAAISW SIA Sbjct: 170 RGEE---TLEVRHWRRNSDAWAHRNKRKAAISWQSIA 203 >XP_016194774.1 PREDICTED: 60S ribosomal protein L2, mitochondrial [Arachis ipaensis] Length = 211 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 RGEE+ L+VRNWK+N+D W HRNKRKAAISWH IA Sbjct: 177 RGEEK---LEVRNWKKNNDVWTHRNKRKAAISWHGIA 210 >NP_001238387.1 uncharacterized protein LOC100527336 [Glycine max] ACU16409.1 unknown [Glycine max] Length = 204 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 468 EALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 E L+VR+W+RNSDAWAHRNKRKAAISW SIA Sbjct: 173 ETLEVRHWRRNSDAWAHRNKRKAAISWQSIA 203 >XP_015962946.1 PREDICTED: 60S ribosomal protein L2, mitochondrial [Arachis duranensis] Length = 211 Score = 61.2 bits (147), Expect = 2e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSI 379 RGEE+ LQVRNWK+N+D W HRNKRKAAISWH I Sbjct: 177 RGEEK---LQVRNWKKNNDVWTHRNKRKAAISWHGI 209 >XP_014496635.1 PREDICTED: 60S ribosomal protein L2, mitochondrial [Vigna radiata var. radiata] Length = 209 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 RG+ E + L+VRNWKRNSDAWAHRNKR+ A+SW SIA Sbjct: 173 RGKGE-KTLEVRNWKRNSDAWAHRNKRRVAVSWQSIA 208 >GAU16497.1 hypothetical protein TSUD_167290 [Trifolium subterraneum] Length = 212 Score = 60.8 bits (146), Expect = 3e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 468 EALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 E L++RNWK+NSD W HRNKRKAAISWH+IA Sbjct: 182 EKLEIRNWKKNSDVWMHRNKRKAAISWHNIA 212 >XP_004489113.1 PREDICTED: 60S ribosomal protein L2, mitochondrial [Cicer arietinum] Length = 208 Score = 60.1 bits (144), Expect = 5e-08 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 +GEE+ +++RNWK+NSD W HRNKRKAAISWH++A Sbjct: 175 KGEEK---MEIRNWKKNSDVWMHRNKRKAAISWHTVA 208 >XP_007139148.1 hypothetical protein PHAVU_008G005400g [Phaseolus vulgaris] XP_007139149.1 hypothetical protein PHAVU_008G005400g [Phaseolus vulgaris] ESW11142.1 hypothetical protein PHAVU_008G005400g [Phaseolus vulgaris] ESW11143.1 hypothetical protein PHAVU_008G005400g [Phaseolus vulgaris] Length = 205 Score = 59.7 bits (143), Expect = 6e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 468 EALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 E L+VRNW+RNSD WAHRNKRK A+SW SIA Sbjct: 174 ETLEVRNWRRNSDGWAHRNKRKVAVSWQSIA 204 >XP_019418837.1 PREDICTED: uncharacterized protein LOC109329597 [Lupinus angustifolius] XP_019418844.1 PREDICTED: uncharacterized protein LOC109329597 [Lupinus angustifolius] OIW17570.1 hypothetical protein TanjilG_08848 [Lupinus angustifolius] Length = 203 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 477 EEGEALQVRNWKRNSDAWAHRNKRKAAISWHSI 379 EEG LQVRNWKRNSD W +RNKRKAAISWH+I Sbjct: 172 EEG-LLQVRNWKRNSDVWKNRNKRKAAISWHNI 203 >XP_013447445.1 60S ribosomal protein L2, related protein [Medicago truncatula] KEH21526.1 60S ribosomal protein L2, related protein [Medicago truncatula] Length = 208 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 474 EGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 +GE L++RNWK+NSD W +RNKRK AISW +IA Sbjct: 176 DGEKLEIRNWKKNSDVWMNRNKRKTAISWQNIA 208 >XP_017408961.1 PREDICTED: 60S ribosomal protein L2, mitochondrial [Vigna angularis] KOM28501.1 hypothetical protein LR48_Vigan549s005600 [Vigna angularis] BAT82977.1 hypothetical protein VIGAN_04006700 [Vigna angularis var. angularis] Length = 209 Score = 56.6 bits (135), Expect = 9e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -3 Query: 486 RGEEEGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 RG+ E + L+VR W+RNSDAWAHRNKR+ A+SW SIA Sbjct: 173 RGKGE-DTLEVRIWRRNSDAWAHRNKRRVAVSWQSIA 208 >ACJ84815.1 unknown [Medicago truncatula] Length = 208 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 474 EGEALQVRNWKRNSDAWAHRNKRKAAISWHSIA 376 +GE L++RNWK++SD W +RNKRK AISW +IA Sbjct: 176 DGEKLEIRNWKKSSDVWMNRNKRKTAISWQNIA 208