BLASTX nr result
ID: Glycyrrhiza28_contig00005623
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00005623 (805 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH24545.1 hypothetical protein GLYMA_12G048000 [Glycine max] 63 1e-09 KHN25334.1 hypothetical protein glysoja_010251 [Glycine soja] 58 1e-07 OIV99452.1 hypothetical protein TanjilG_17262 [Lupinus angustifo... 57 2e-07 KOM50847.1 hypothetical protein LR48_Vigan08g167400 [Vigna angul... 55 2e-06 >KRH24545.1 hypothetical protein GLYMA_12G048000 [Glycine max] Length = 76 Score = 63.2 bits (152), Expect = 1e-09 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +3 Query: 306 MSAIVEVWVGELSKLREKVLTRNSKLLLFKAKEGSEVEIAAEKEAHQKKENNNM 467 MSA+V+VWVGEL+KLREKVL R K LL +AKEGSE EKE +KKEN N+ Sbjct: 1 MSAMVQVWVGELTKLREKVLPR--KPLLSEAKEGSERNQEEEKETQKKKENTNI 52 >KHN25334.1 hypothetical protein glysoja_010251 [Glycine soja] Length = 76 Score = 58.2 bits (139), Expect = 1e-07 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +3 Query: 306 MSAIVEVWVGELSKLREKVLTRNSKLLLFKAKEGSEVEIAAEKEAHQKKENNNM 467 MSA+V+VWVGEL+KLREKVL R K LL +AK GSE EKE +KKEN + Sbjct: 1 MSAMVQVWVGELTKLREKVLPR--KPLLSEAKVGSERNQEEEKETQKKKENTKI 52 >OIV99452.1 hypothetical protein TanjilG_17262 [Lupinus angustifolius] Length = 69 Score = 57.4 bits (137), Expect = 2e-07 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +3 Query: 306 MSAIVEVWVGELSKLREKVLTRNSKLLLFKAKEGSEVEIAAEKEAHQKKENNNMAXS 476 MSA+VEVWVGEL+KL EKVL R + L K K+GSEVEI ++ +N+ M+ S Sbjct: 1 MSAMVEVWVGELTKLTEKVLARKPLMKLPKEKQGSEVEIKEAQKKESVGDNSTMSES 57 >KOM50847.1 hypothetical protein LR48_Vigan08g167400 [Vigna angularis] BAT90876.1 hypothetical protein VIGAN_06216700 [Vigna angularis var. angularis] Length = 72 Score = 54.7 bits (130), Expect = 2e-06 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +3 Query: 306 MSAIVEVWVGELSKLREKVLTRNSKLLLFKAKEGSEVEIAAEKEAHQK 449 MSA+VEVWVGEL+KLREKVL+R K L KAKEGSE E E EA +K Sbjct: 1 MSAVVEVWVGELAKLREKVLSR--KPFLSKAKEGSERE-QEEMEAQKK 45