BLASTX nr result
ID: Glycyrrhiza28_contig00004631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00004631 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK41731.1 unknown [Medicago truncatula] 58 2e-08 >AFK41731.1 unknown [Medicago truncatula] Length = 70 Score = 57.8 bits (138), Expect = 2e-08 Identities = 30/58 (51%), Positives = 31/58 (53%) Frame = +1 Query: 325 YRSSRTMXXXXXXXXXXXXXXXXXFLSLSTPKSVTRTRAPLQPSG*PKDTAPPCKFTF 498 +RSS T F STPKSVTR RAPLQP G P DTAPPC FTF Sbjct: 5 HRSSTTRADAPPPPLQTPPTPYFPFFCFSTPKSVTRIRAPLQPRGWPNDTAPPCTFTF 62