BLASTX nr result
ID: Glycyrrhiza28_contig00004552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00004552 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK41721.1 unknown [Lotus japonicus] 101 4e-24 KYP40180.1 Cysteine proteinase inhibitor 12 [Cajanus cajan] 100 2e-23 XP_016170903.1 PREDICTED: cysteine proteinase inhibitor 6 [Arach... 99 4e-23 XP_015937079.1 PREDICTED: cysteine proteinase inhibitor 6 [Arach... 99 4e-23 KHN37731.1 Cysteine proteinase inhibitor 12 [Glycine soja] KRH20... 99 6e-23 KHN11196.1 Cysteine proteinase inhibitor 12 [Glycine soja] 99 6e-23 NP_001237734.1 cysteine proteinase inhibitor precursor [Glycine ... 99 6e-23 ACU24145.1 unknown [Glycine max] 99 6e-23 XP_019434748.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 98 8e-23 XP_003628013.1 cysteine protease inhibitor cystatin [Medicago tr... 97 1e-22 XP_014505181.1 PREDICTED: cysteine proteinase inhibitor 6 [Vigna... 97 2e-22 XP_004511090.1 PREDICTED: cysteine proteinase inhibitor 6 [Cicer... 96 5e-22 GAU18485.1 hypothetical protein TSUD_366680 [Trifolium subterran... 95 7e-22 NP_001237443.1 uncharacterized protein LOC100499887 precursor [G... 96 9e-22 AFK34375.1 unknown [Medicago truncatula] 95 1e-21 XP_017408788.1 PREDICTED: cysteine proteinase inhibitor 6 [Vigna... 94 2e-21 XP_007133641.1 hypothetical protein PHAVU_011G196600g [Phaseolus... 94 2e-21 XP_019449328.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 90 1e-19 XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 84 7e-18 XP_018849381.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 85 1e-17 >AFK41721.1 unknown [Lotus japonicus] Length = 237 Score = 101 bits (251), Expect = 4e-24 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDDVAKFN+LLK+KRGEKEEKFKVE+HKNNEG FHLNQME Sbjct: 182 ELHEVADAKAEVIDDVAKFNILLKLKRGEKEEKFKVEVHKNNEGSFHLNQME 233 >KYP40180.1 Cysteine proteinase inhibitor 12 [Cajanus cajan] Length = 238 Score = 99.8 bits (247), Expect = 2e-23 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRGEKEEKFKVE+HKNN+G FHLNQME Sbjct: 183 ELHEVADAKAEVIDDFAKFNLLLKVKRGEKEEKFKVEVHKNNQGGFHLNQME 234 >XP_016170903.1 PREDICTED: cysteine proteinase inhibitor 6 [Arachis ipaensis] Length = 241 Score = 99.0 bits (245), Expect = 4e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 +LHEV DAKAEVIDD+AKFNLLLKVKRGEKEEKFKVE+HKNNEGRF+LNQME Sbjct: 186 QLHEVVDAKAEVIDDLAKFNLLLKVKRGEKEEKFKVEVHKNNEGRFNLNQME 237 >XP_015937079.1 PREDICTED: cysteine proteinase inhibitor 6 [Arachis duranensis] Length = 242 Score = 99.0 bits (245), Expect = 4e-23 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 +LHEV DAKAEVIDD+AKFNLLLKVKRGEKEEKFKVE+HKNNEGRF+LNQME Sbjct: 187 QLHEVVDAKAEVIDDLAKFNLLLKVKRGEKEEKFKVEVHKNNEGRFNLNQME 238 >KHN37731.1 Cysteine proteinase inhibitor 12 [Glycine soja] KRH20612.1 hypothetical protein GLYMA_13G189500 [Glycine max] Length = 245 Score = 98.6 bits (244), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNN+G FHLNQME Sbjct: 190 ELHEVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >KHN11196.1 Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 98.6 bits (244), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNN+G FHLNQME Sbjct: 190 ELHEVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >NP_001237734.1 cysteine proteinase inhibitor precursor [Glycine max] BAA19608.1 cysteine proteinase inhibitor [Glycine max] BAA19610.1 cysteine proteinase inhibitor [Glycine max] KRH13275.1 hypothetical protein GLYMA_15G227500 [Glycine max] Length = 245 Score = 98.6 bits (244), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNN+G FHLNQME Sbjct: 190 ELHEVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >ACU24145.1 unknown [Glycine max] Length = 245 Score = 98.6 bits (244), Expect = 6e-23 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNN+G FHLNQME Sbjct: 190 ELHEVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQME 241 >XP_019434748.1 PREDICTED: cysteine proteinase inhibitor 6-like [Lupinus angustifolius] XP_019434749.1 PREDICTED: cysteine proteinase inhibitor 6-like [Lupinus angustifolius] OIV89378.1 hypothetical protein TanjilG_22341 [Lupinus angustifolius] Length = 243 Score = 98.2 bits (243), Expect = 8e-23 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEV DAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNNEG FHLNQME Sbjct: 188 ELHEVVDAKAEVIDDFAKFNLLLKVKRGDKEEKFKVEVHKNNEGGFHLNQME 239 >XP_003628013.1 cysteine protease inhibitor cystatin [Medicago truncatula] AET02489.1 cysteine protease inhibitor cystatin [Medicago truncatula] Length = 241 Score = 97.4 bits (241), Expect = 1e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEV DAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKN+EG FHLNQME Sbjct: 186 ELHEVTDAKAEVIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQME 237 >XP_014505181.1 PREDICTED: cysteine proteinase inhibitor 6 [Vigna radiata var. radiata] Length = 246 Score = 97.1 bits (240), Expect = 2e-22 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -2 Query: 355 LHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 LHEVADAKAEVIDD AKFNLLLKVKRGEKEEKFKVE+HKNNEG HLNQME Sbjct: 192 LHEVADAKAEVIDDFAKFNLLLKVKRGEKEEKFKVEVHKNNEGALHLNQME 242 >XP_004511090.1 PREDICTED: cysteine proteinase inhibitor 6 [Cicer arietinum] Length = 247 Score = 96.3 bits (238), Expect = 5e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEV DAKAEVIDDVA FNLLLK+KRG KEEKFKVE+HKNNEG FHLNQME Sbjct: 192 ELHEVVDAKAEVIDDVANFNLLLKLKRGAKEEKFKVEVHKNNEGTFHLNQME 243 >GAU18485.1 hypothetical protein TSUD_366680 [Trifolium subterraneum] Length = 204 Score = 94.7 bits (234), Expect = 7e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEV DAKAEV DDVAKF+LLLKVKRGEKEEKFKVE+HKN EG FHLNQME Sbjct: 149 ELHEVTDAKAEVNDDVAKFSLLLKVKRGEKEEKFKVEVHKNTEGSFHLNQME 200 >NP_001237443.1 uncharacterized protein LOC100499887 precursor [Glycine max] ACU14063.1 unknown [Glycine max] Length = 245 Score = 95.5 bits (236), Expect = 9e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNN+ FHLNQME Sbjct: 190 ELHEVADAKAEVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQRGFHLNQME 241 >AFK34375.1 unknown [Medicago truncatula] Length = 241 Score = 95.1 bits (235), Expect = 1e-21 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHEV DAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+HKN+E FHLNQME Sbjct: 186 ELHEVTDAKAEVIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSESNFHLNQME 237 >XP_017408788.1 PREDICTED: cysteine proteinase inhibitor 6 [Vigna angularis] KOM28344.1 hypothetical protein LR48_Vigan528s001500 [Vigna angularis] BAT89361.1 hypothetical protein VIGAN_06030100 [Vigna angularis var. angularis] Length = 246 Score = 94.4 bits (233), Expect = 2e-21 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -2 Query: 355 LHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 LHEVADAKAEVIDD AKFNLLLKVKRG+KEEKFKVE+H+NNEG HLNQME Sbjct: 192 LHEVADAKAEVIDDFAKFNLLLKVKRGDKEEKFKVEVHQNNEGALHLNQME 242 >XP_007133641.1 hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] ESW05635.1 hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] Length = 246 Score = 94.4 bits (233), Expect = 2e-21 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -2 Query: 355 LHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 LHEV DAKAEV+DD AKFNLLLKVKRGEKEEKFKVE+HKNN+G HLNQME Sbjct: 192 LHEVTDAKAEVVDDFAKFNLLLKVKRGEKEEKFKVEVHKNNQGELHLNQME 242 >XP_019449328.1 PREDICTED: cysteine proteinase inhibitor 6-like [Lupinus angustifolius] OIW08132.1 hypothetical protein TanjilG_06675 [Lupinus angustifolius] Length = 238 Score = 89.7 bits (221), Expect = 1e-19 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 ELHE+ DA AEVIDD AKFNLLLKVKRG+KEEKFKVE+HKNNEG F+LN +E Sbjct: 183 ELHEIVDANAEVIDDSAKFNLLLKVKRGDKEEKFKVEVHKNNEGGFNLNHLE 234 >XP_008245659.1 PREDICTED: cysteine proteinase inhibitor 12-like [Prunus mume] Length = 166 Score = 83.6 bits (205), Expect = 7e-18 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 EL EV AKAEVI++ AKFN+LLK+KRG+KEEKFKVE+HKNNEG F LNQME Sbjct: 111 ELQEVVHAKAEVIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGAFKLNQME 162 >XP_018849381.1 PREDICTED: cysteine proteinase inhibitor 12-like [Juglans regia] Length = 243 Score = 84.7 bits (208), Expect = 1e-17 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 358 ELHEVADAKAEVIDDVAKFNLLLKVKRGEKEEKFKVELHKNNEGRFHLNQME 203 EL EV AKAEVI+D AKF+LLL +KRG KEEKFKVE+HKNNEG FHLNQME Sbjct: 188 ELQEVIHAKAEVIEDFAKFDLLLNLKRGNKEEKFKVEVHKNNEGGFHLNQME 239