BLASTX nr result
ID: Glycyrrhiza28_contig00004340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00004340 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholder... 238 1e-77 BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BA... 238 1e-77 BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BA... 238 1e-77 BAG46932.1 cell wall-associated hydrolase [Burkholderia multivor... 238 1e-77 CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] 231 1e-75 CWO79403.1 Cell wall-associated hydrolase [Neisseria meningitidi... 231 5e-75 CWP67249.1 Cell wall-associated hydrolase [Neisseria meningitidi... 231 5e-75 CWP48701.1 Cell wall-associated hydrolase [Neisseria meningitidi... 231 5e-75 CKL43271.1 Cell wall-associated hydrolase [Neisseria meningitidi... 231 5e-75 CNS09044.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae... 231 5e-75 EEW06587.1 conserved hypothetical protein [Vibrio mimicus VM603] 226 6e-74 KNH50143.1 cell wall-associated hydrolase, partial [Vibrio chole... 225 6e-74 EGR05231.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] 225 1e-73 KNH56572.1 cell wall-associated hydrolase, partial [Vibrio chole... 225 1e-73 ELT25191.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] 225 1e-73 EGQ96299.1 cell wall-associated hydrolase [Vibrio cholerae HCUF0... 225 1e-73 KTD17649.1 Cell wall-associated hydrolase [Legionella jordanis] 224 2e-73 KTC66799.1 Cell wall-associated hydrolase [Legionella birmingham... 223 2e-73 EDL68006.1 cell wall-associated hydrolase [Vibrio campbellii HY0... 224 2e-73 ADT85291.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC... 224 2e-73 >KNH03717.1 Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 238 bits (608), Expect = 1e-77 Identities = 117/140 (83%), Positives = 120/140 (85%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAPFK+PTPTADRDQTVSRR +PSSRT Sbjct: 3 SAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 +LNGEQPYPWDRLQPQD MSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 SLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YDXXXXXXXXXXXXXXTLMP 420 YD TLMP Sbjct: 123 YDLLSHLLDLSVSQLSTLMP 142 >BAO87435.1 putative membrane protein [Burkholderia sp. RPE67] BAO87487.1 putative membrane protein [Burkholderia sp. RPE67] BAO87598.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 238 bits (608), Expect = 1e-77 Identities = 117/140 (83%), Positives = 120/140 (85%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAPFK+PTPTADRDQTVSRR +PSSRT Sbjct: 3 SAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 +LNGEQPYPWDRLQPQD MSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 SLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YDXXXXXXXXXXXXXXTLMP 420 YD TLMP Sbjct: 123 YDLLSHLLDLSVSQLSTLMP 142 >BAO86772.1 putative membrane protein [Burkholderia sp. RPE67] BAO88159.1 putative membrane protein [Burkholderia sp. RPE67] BAO90886.1 putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 238 bits (608), Expect = 1e-77 Identities = 117/140 (83%), Positives = 120/140 (85%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAPFK+PTPTADRDQTVSRR +PSSRT Sbjct: 3 SAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 +LNGEQPYPWDRLQPQD MSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 SLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YDXXXXXXXXXXXXXXTLMP 420 YD TLMP Sbjct: 123 YDLLSHLLDLSVSQLSTLMP 142 >BAG46932.1 cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 238 bits (608), Expect = 1e-77 Identities = 117/140 (83%), Positives = 120/140 (85%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVISSEHSYPAM LA QPVHQRFVHSGPLVLGAAPFK+PTPTADRDQTVSRR +PSSRT Sbjct: 3 SAVISSEHSYPAMRLASQPVHQRFVHSGPLVLGAAPFKYPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 +LNGEQPYPWDRLQPQD MSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 SLNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YDXXXXXXXXXXXXXXTLMP 420 YD TLMP Sbjct: 123 YDLLSHLLDLSVSQLSTLMP 142 >CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 177 Score = 231 bits (589), Expect = 1e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >CWO79403.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS73015.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP48004.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT53749.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP56073.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT45211.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP40556.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS34214.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 231 bits (589), Expect = 5e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >CWP67249.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT59615.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS18382.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR45378.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ16501.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN87478.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM92680.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN67326.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP45878.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP38468.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ30366.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO45593.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT45368.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM35122.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ61517.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR11989.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT68492.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP89907.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM28216.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ55809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM90768.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ97896.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS39350.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO06049.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN51672.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM72155.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO27120.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN29951.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ78977.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ62225.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS89623.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM32710.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 231 bits (589), Expect = 5e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >CWP48701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR29009.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR82218.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR46809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS91548.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN30464.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN27922.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS66742.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR06838.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR48486.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR10327.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN24095.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO60614.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN25947.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS98001.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS59497.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN72848.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP39092.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ32365.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR13329.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR32013.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO15311.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO60288.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO73300.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO97724.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM32626.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR46169.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR60621.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS55187.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO74333.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS49369.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN33205.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT97847.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO92715.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT28786.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS90747.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM57104.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS63743.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO03883.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS61697.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO81400.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT19600.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS68250.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO24807.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT09763.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR74708.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP19917.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP84832.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP03601.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS70498.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN63518.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS36222.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR66421.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO88263.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO98192.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS47444.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT98357.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS64753.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS46428.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS76708.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO66988.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM84030.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR78250.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS34318.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT95575.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM57972.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ57771.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ39864.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO66358.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM94174.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP76809.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO82057.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO41141.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO43448.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR92606.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO68101.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP03041.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR09158.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ50251.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR40772.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO02003.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN69442.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM99199.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS97164.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO86758.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS41307.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT95437.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM63050.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP38428.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM29569.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR37263.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR81410.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT48259.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM97468.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN50119.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM76951.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN34996.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR65665.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP39424.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ41661.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN92488.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ79228.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWM13605.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT09979.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT10765.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN20861.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT20193.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP85087.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWQ46953.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO47217.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR53907.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWN72701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT19570.1 Cell wall-associated hydrolase [Neisseria meningitidis] ANW90621.1 hypothetical protein DE8555_0048 [Neisseria meningitidis] ANW92138.1 hypothetical protein DE8555_1596 [Neisseria meningitidis] ANW92423.1 hypothetical protein DE8555_1889 [Neisseria meningitidis] ANW92538.1 hypothetical protein DE8555_2009 [Neisseria meningitidis] Length = 216 Score = 231 bits (589), Expect = 5e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >CKL43271.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR65376.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO43812.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS31701.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWR93279.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWT88142.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWP62169.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWO09337.1 Cell wall-associated hydrolase [Neisseria meningitidis] CWS97823.1 Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 231 bits (589), Expect = 5e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >CNS09044.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN05702.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN12195.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN08284.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN16001.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBM98005.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN00296.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN07672.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBM92021.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBM98469.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN02983.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN10314.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] SBN06757.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 216 Score = 231 bits (589), Expect = 5e-75 Identities = 112/121 (92%), Positives = 114/121 (94%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+ISSE SYPAM LA QPVHQRFVHSGPLVLGAAP K PTPTADRDQTVSRR +PSSRT Sbjct: 3 SALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVSRRFKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAKL RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKLRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 Y 363 Y Sbjct: 123 Y 123 >EEW06587.1 conserved hypothetical protein [Vibrio mimicus VM603] Length = 144 Score = 226 bits (575), Expect = 6e-74 Identities = 110/122 (90%), Positives = 112/122 (91%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVI SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >KNH50143.1 cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 124 Score = 225 bits (573), Expect = 6e-74 Identities = 109/122 (89%), Positives = 113/122 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+I+SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >EGR05231.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] Length = 142 Score = 225 bits (573), Expect = 1e-73 Identities = 109/122 (89%), Positives = 113/122 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+I+SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >KNH56572.1 cell wall-associated hydrolase, partial [Vibrio cholerae 1587] Length = 144 Score = 225 bits (573), Expect = 1e-73 Identities = 109/122 (89%), Positives = 113/122 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+I+SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >ELT25191.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] Length = 144 Score = 225 bits (573), Expect = 1e-73 Identities = 109/122 (89%), Positives = 113/122 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+I+SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SALINSELSYRAMRLAAQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >EGQ96299.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] EGQ96548.1 cell wall-associated hydrolase [Vibrio cholerae HC-49A2] EGR02094.1 cell wall-associated hydrolase [Vibrio cholerae HE39] EGR02318.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] EGR03030.1 cell wall-associated hydrolase [Vibrio cholerae HC-49A2] EGR04708.1 cell wall-associated hydrolase [Vibrio cholerae HC-49A2] EGR05224.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] EGR06323.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] EGR06675.1 cell wall-associated hydrolase [Vibrio cholerae HC-49A2] EGR06682.1 cell wall-associated hydrolase [Vibrio cholerae HCUF01] EGR06873.1 cell wall-associated hydrolase [Vibrio cholerae HC-49A2] EGR08438.1 cell wall-associated hydrolase [Vibrio cholerae HE48] EGR09075.1 cell wall-associated hydrolase [Vibrio cholerae HE48] EGR09451.1 cell wall-associated hydrolase [Vibrio cholerae HE48] EGR10575.1 cell wall-associated hydrolase [Vibrio cholerae HE48] EHI04054.1 cell wall-associated hydrolase [Vibrio cholerae HC-61A1] EJH27867.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH32062.1 cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] EJH33416.1 cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] EJH33672.1 cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] EJH33798.1 cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] EJH34148.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH34893.1 cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] EJH36297.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH36741.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH37018.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH37188.1 cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] EJH38994.1 cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] EJH42095.1 cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] EJH43806.1 cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] EJH46636.1 cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] EJH46998.1 cell wall-associated hydrolase [Vibrio cholerae CP1046(19)] EJH47016.1 cell wall-associated hydrolase [Vibrio cholerae CP1046(19)] EJH48747.1 cell wall-associated hydrolase [Vibrio cholerae CP1048(21)] EJH64979.1 cell wall-associated hydrolase [Vibrio cholerae HE-25] EJH65992.1 cell wall-associated hydrolase [Vibrio cholerae HE-45] EKL19741.1 cell wall-associated hydrolase family protein [Vibrio cholerae HC-61A2] ELT24219.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] ELT25911.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] ELT27345.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] ELT27351.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] ELT27499.1 cell wall-associated hydrolase [Vibrio cholerae HC-7A1] ELT40310.1 cell wall-associated hydrolase [Vibrio cholerae HC-81A1] ELT41152.1 cell wall-associated hydrolase [Vibrio cholerae HC-81A1] ELT42334.1 cell wall-associated hydrolase [Vibrio cholerae HC-81A1] CSC65776.1 Cell wall-associated hydrolase [Vibrio cholerae] CSC45210.1 Cell wall-associated hydrolase [Vibrio cholerae] CSD16164.1 Cell wall-associated hydrolase [Vibrio cholerae] CSC57916.1 Cell wall-associated hydrolase [Vibrio cholerae] CSB16218.1 Cell wall-associated hydrolase [Vibrio cholerae] CSC86490.1 Cell wall-associated hydrolase [Vibrio cholerae] CSA58297.1 Cell wall-associated hydrolase [Vibrio cholerae] CSA81106.1 Cell wall-associated hydrolase [Vibrio cholerae] CSD11689.1 Cell wall-associated hydrolase [Vibrio cholerae] Length = 144 Score = 225 bits (573), Expect = 1e-73 Identities = 109/122 (89%), Positives = 113/122 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SA+I+SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >KTD17649.1 Cell wall-associated hydrolase [Legionella jordanis] Length = 122 Score = 224 bits (570), Expect = 2e-73 Identities = 109/120 (90%), Positives = 111/120 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVI SE SYPAM LA QPVHQRFVHSGPLVLGAAP FPTPTADRD+TVSRRS+PSSRT Sbjct: 3 SAVIPSELSYPAMQLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWD LQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 >KTC66799.1 Cell wall-associated hydrolase [Legionella birminghamensis] KTD49697.1 Cell wall-associated hydrolase [Legionella quinlivanii] Length = 122 Score = 223 bits (569), Expect = 2e-73 Identities = 109/120 (90%), Positives = 111/120 (92%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVI SE SYPAM LA QPVHQRFVHSGPLVLGAAP FPTPTADRD+TVSRRS+PSSRT Sbjct: 3 SAVIPSELSYPAMRLASQPVHQRFVHSGPLVLGAAPLNFPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWD LQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFHTEPPDH Sbjct: 63 TLNGEQPYPWDLLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 122 >EDL68006.1 cell wall-associated hydrolase [Vibrio campbellii HY01] EDL68619.1 cell wall-associated hydrolase [Vibrio campbellii HY01] EDM57517.1 cell wall-associated hydrolase [Vibrio parahaemolyticus AQ3810] EDM57831.1 cell wall-associated hydrolase [Vibrio parahaemolyticus AQ3810] ABU69241.1 hypothetical protein VIBHAR_00194 [Vibrio campbellii ATCC BAA-1116] ABU69243.1 hypothetical protein VIBHAR_00200 [Vibrio campbellii ATCC BAA-1116] ABU69352.1 hypothetical protein VIBHAR_00327 [Vibrio campbellii ATCC BAA-1116] ABU69481.1 hypothetical protein VIBHAR_00471 [Vibrio campbellii ATCC BAA-1116] ABU72531.1 hypothetical protein VIBHAR_03613 [Vibrio campbellii ATCC BAA-1116] ABU72630.1 hypothetical protein VIBHAR_03718 [Vibrio campbellii ATCC BAA-1116] EED24664.1 cell wall-associated hydrolase [Vibrio sp. 16] EED25005.1 cell wall-associated hydrolase [Vibrio sp. 16] EED25268.1 cell wall-associated hydrolase [Vibrio sp. 16] EED25341.1 cell wall-associated hydrolase [Vibrio sp. 16] EED25788.1 cell wall-associated hydrolase [Vibrio sp. 16] EED25881.1 cell wall-associated hydrolase [Vibrio sp. 16] EED26765.1 cell wall-associated hydrolase [Vibrio sp. 16] EFO36912.1 cell wall-associated hydrolase [Vibrio parahaemolyticus Peru-466] EFO37705.1 cell wall-associated hydrolase [Vibrio parahaemolyticus Peru-466] EFO47107.1 cell wall-associated hydrolase [Vibrio parahaemolyticus AQ4037] EQM45162.1 hypothetical protein D042_3233 [Vibrio parahaemolyticus NIHCB0757] EQM50448.1 cell wall-associated hydrolase domain protein [Vibrio parahaemolyticus VPCR-2010] EQM50590.1 hypothetical protein D051_5813 [Vibrio parahaemolyticus VPCR-2010] Length = 144 Score = 224 bits (571), Expect = 2e-73 Identities = 109/122 (89%), Positives = 112/122 (91%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVI SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFH+EPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHSEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124 >ADT85291.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT85489.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT85587.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT85706.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT86000.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT86209.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] ADT88234.1 Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] Length = 144 Score = 224 bits (571), Expect = 2e-73 Identities = 109/122 (89%), Positives = 112/122 (91%) Frame = +1 Query: 1 SAVISSEHSYPAMPLA*QPVHQRFVHSGPLVLGAAPFKFPTPTADRDQTVSRRSEPSSRT 180 SAVI SE SY AM LA QP HQRFVHSGPLVLGAAPF PTPTADRD+TVSRRS+PSSRT Sbjct: 3 SAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSSRT 62 Query: 181 TLNGEQPYPWDRLQPQDVMSRHRGAKLPRRYELLGGISLLSPEYLLSVERWPFHTEPPDH 360 TLNGEQPYPWDRLQPQDVMSRHRGAK RRYELLGGISLLSPEYLLSVERWPFH+EPPDH Sbjct: 63 TLNGEQPYPWDRLQPQDVMSRHRGAKHRRRYELLGGISLLSPEYLLSVERWPFHSEPPDH 122 Query: 361 YD 366 YD Sbjct: 123 YD 124