BLASTX nr result
ID: Glycyrrhiza28_contig00004171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00004171 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMV78111.1 hypothetical protein HMPREF0979_01152 [Coprobacillus ... 77 5e-17 CDP56660.1 hypothetical protein BN969_23530 [Staphylococcus aure... 67 3e-13 AOE07960.1 hypothetical protein [uncultured bacterium] 68 4e-13 EDN81767.1 hypothetical protein ACTODO_00001 [Actinomyces odonto... 67 6e-13 EDK87970.1 hypothetical protein FNP_0151 [Fusobacterium nucleatu... 64 8e-12 EBA39187.1 hypothetical protein COLAER_01802 [Collinsella aerofa... 59 2e-09 EDP22130.1 hypothetical protein FAEPRAM212_01166 [Faecalibacteri... 57 3e-09 ABZ84907.1 conserved hypothetical protein [Heliobacterium modest... 60 3e-09 JAN89529.1 hypothetical protein [Daphnia magna] 58 3e-09 GAN74957.1 hypothetical protein Apmu_0247_01 [Acidiphilium multi... 60 3e-09 AGC72090.1 hypothetical protein [uncultured bacterium A1Q1_fos_291] 56 4e-09 JAN88726.1 hypothetical protein [Daphnia magna] 58 4e-09 EBA38630.1 hypothetical protein COLAER_02284 [Collinsella aerofa... 59 6e-09 EDP22260.1 hypothetical protein FAEPRAM212_00883 [Faecalibacteri... 56 6e-09 OBV21546.1 hypothetical protein SAHC556_03075 [Staphylococcus au... 56 6e-09 GAN72223.1 hypothetical protein Absy_048_002 [Acetobacter syzygi... 54 1e-08 EFJ63628.1 hypothetical protein HMPREF9553_00243, partial [Esche... 57 2e-08 EFO50065.1 conserved hypothetical protein [Vibrio parahaemolytic... 56 2e-08 KQK85721.1 hypothetical protein SETIT_020890mg [Setaria italica] 54 3e-08 JAN94712.1 hypothetical protein, partial [Daphnia magna] 54 6e-08 >KMV78111.1 hypothetical protein HMPREF0979_01152 [Coprobacillus sp. 8_1_38FAA] Length = 78 Score = 77.4 bits (189), Expect = 5e-17 Identities = 41/57 (71%), Positives = 42/57 (73%) Frame = -1 Query: 171 LRDLTQHLTTRADDNHAPPVHQPQRERPSLARSGICQALVRFFALHRINPHAPPLVR 1 +RDLTQHLTTRADDNHAPPV PSL CQ LVRFFAL RI PHAPPLVR Sbjct: 1 MRDLTQHLTTRADDNHAPPVFSIAIS-PSLEPLDRCQDLVRFFALLRIKPHAPPLVR 56 >CDP56660.1 hypothetical protein BN969_23530 [Staphylococcus aureus subsp. aureus] CDP55917.1 hypothetical protein BN969_16000 [Staphylococcus aureus subsp. aureus] CDP55518.1 hypothetical protein BN969_11940 [Staphylococcus aureus subsp. aureus] CDP55159.1 hypothetical protein BN969_7980 [Staphylococcus aureus subsp. aureus] CDP54869.1 hypothetical protein BN969_5040 [Staphylococcus aureus subsp. aureus] CDP54866.1 hypothetical protein BN969_4990 [Staphylococcus aureus subsp. aureus] CDP54638.1 hypothetical protein BN969_2590 [Staphylococcus aureus subsp. aureus] CDP54452.1 hypothetical protein BN969_530 [Staphylococcus aureus subsp. aureus] Length = 63 Score = 67.4 bits (163), Expect = 3e-13 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +1 Query: 1 PHKRRSMWINSMQREEPYQGLTYTGTGQRWSFPL-WLVYRWCMVVVSSCREMLG 159 PHKR SMW NS QREEPYQ LT + +FP RWCMVVVSSCREMLG Sbjct: 10 PHKRWSMWFNSKQREEPYQILTSFDNSRDRAFPFGGQSDRWCMVVVSSCREMLG 63 >AOE07960.1 hypothetical protein [uncultured bacterium] Length = 85 Score = 67.8 bits (164), Expect = 4e-13 Identities = 38/60 (63%), Positives = 40/60 (66%) Frame = -1 Query: 180 LRSLRDLTQHLTTRADDNHAPPVHQPQRERPSLARSGICQALVRFFALHRINPHAPPLVR 1 +RSLRDLTQHLT RADDNHA P + E A S A VRF A HRI PHAPPLVR Sbjct: 1 MRSLRDLTQHLTARADDNHAAPCFVSE-ELCISADSTRILAQVRFLAYHRIKPHAPPLVR 59 >EDN81767.1 hypothetical protein ACTODO_00001 [Actinomyces odontolyticus ATCC 17982] Length = 88 Score = 67.4 bits (163), Expect = 6e-13 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 110 CTGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 C GGAWLSSARVVRCWVKSRNERNPC MLPA Sbjct: 7 CAGGAWLSSARVVRCWVKSRNERNPCPMLPA 37 >EDK87970.1 hypothetical protein FNP_0151 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 51 Score = 63.5 bits (153), Expect = 8e-12 Identities = 31/40 (77%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 210 QPNAGNIRQGLRSLRDLTQHLTTRADDNHAPPVHQ-PQRE 94 Q N GNIR+GLRSLRDLTQHLTTRADD+HAPPV + P+R+ Sbjct: 4 QLNDGNIRKGLRSLRDLTQHLTTRADDSHAPPVFRFPRRD 43 >EBA39187.1 hypothetical protein COLAER_01802 [Collinsella aerofaciens ATCC 25986] Length = 115 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TGGAWLSSARVVRCWVKSRNERNP +LP+ Sbjct: 15 TGGAWLSSARVVRCWVKSRNERNPRRVLPS 44 >EDP22130.1 hypothetical protein FAEPRAM212_01166 [Faecalibacterium prausnitzii M21/2] Length = 163 Score = 57.0 bits (136), Expect(2) = 3e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 80 ARDGLSLCGWCTGGAWLSSARVVRCWVKSRNERNP 184 A + +SL TGGAWLSSARVVRCWVKSRNERNP Sbjct: 21 AGNSISLRSKETGGAWLSSARVVRCWVKSRNERNP 55 Score = 31.6 bits (70), Expect(2) = 3e-09 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 Query: 19 MWINSMQREEPYQGLT 66 MW NS QREEPYQ LT Sbjct: 1 MWFNSTQREEPYQVLT 16 >ABZ84907.1 conserved hypothetical protein [Heliobacterium modesticaldum Ice1] Length = 164 Score = 59.7 bits (143), Expect = 3e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TGGAWLSSARVVRCWVKSRNERNP LPA Sbjct: 11 TGGAWLSSARVVRCWVKSRNERNPYPQLPA 40 >JAN89529.1 hypothetical protein [Daphnia magna] Length = 99 Score = 58.2 bits (139), Expect = 3e-09 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = +2 Query: 89 GLSLCGWCTGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 G S TG AWLSSARVVRCWVKS NERNPC LPA Sbjct: 49 GSSFSWMYTGVAWLSSARVVRCWVKSLNERNPCHYLPA 86 >GAN74957.1 hypothetical protein Apmu_0247_01 [Acidiphilium multivorum AIU301] Length = 168 Score = 59.7 bits (143), Expect = 3e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TG AWLSSARVVRCWVKSRNERNP L LPA Sbjct: 17 TGAAWLSSARVVRCWVKSRNERNPRLQLPA 46 >AGC72090.1 hypothetical protein [uncultured bacterium A1Q1_fos_291] Length = 59 Score = 55.8 bits (133), Expect(2) = 4e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNP 184 TGGAWLSSARVVRCWVKSRNERNP Sbjct: 34 TGGAWLSSARVVRCWVKSRNERNP 57 Score = 32.3 bits (72), Expect(2) = 4e-09 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 Query: 19 MWINSMQREEPYQGLT 66 MW NS QREEPY GLT Sbjct: 1 MWFNSKQREEPYLGLT 16 >JAN88726.1 hypothetical protein [Daphnia magna] Length = 110 Score = 58.2 bits (139), Expect = 4e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPAFGWQHKT 223 TGGAWLSSARVVRCWVKSRNERNP ++ G ++T Sbjct: 17 TGGAWLSSARVVRCWVKSRNERNPYSLVATKGHSNET 53 >EBA38630.1 hypothetical protein COLAER_02284 [Collinsella aerofaciens ATCC 25986] EBA38843.1 hypothetical protein COLAER_01925 [Collinsella aerofaciens ATCC 25986] EBA39061.1 hypothetical protein COLAER_01671 [Collinsella aerofaciens ATCC 25986] Length = 160 Score = 58.9 bits (141), Expect = 6e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TGGAWLSSARVVRCWVKSRNERNP +LP+ Sbjct: 15 TGGAWLSSARVVRCWVKSRNERNPRRVLPS 44 >EDP22260.1 hypothetical protein FAEPRAM212_00883 [Faecalibacterium prausnitzii M21/2] EDP22760.1 hypothetical protein FAEPRAM212_00541 [Faecalibacterium prausnitzii M21/2] EDP22974.1 hypothetical protein FAEPRAM212_00170 [Faecalibacterium prausnitzii M21/2] Length = 163 Score = 55.8 bits (133), Expect(2) = 6e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNP 184 TGGAWLSSARVVRCWVKSRNERNP Sbjct: 32 TGGAWLSSARVVRCWVKSRNERNP 55 Score = 31.6 bits (70), Expect(2) = 6e-09 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 Query: 19 MWINSMQREEPYQGLT 66 MW NS QREEPYQ LT Sbjct: 1 MWFNSTQREEPYQVLT 16 >OBV21546.1 hypothetical protein SAHC556_03075 [Staphylococcus aureus subsp. aureus] Length = 39 Score = 55.8 bits (133), Expect = 6e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNP 184 TGGAWLSSARVVRCWVKSRNERNP Sbjct: 16 TGGAWLSSARVVRCWVKSRNERNP 39 >GAN72223.1 hypothetical protein Absy_048_002 [Acetobacter syzygii 9H-2] Length = 58 Score = 54.3 bits (129), Expect(2) = 1e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCL 190 TG AWLSSARVVRCWVKSRNERNP L Sbjct: 33 TGAAWLSSARVVRCWVKSRNERNPYL 58 Score = 32.0 bits (71), Expect(2) = 1e-08 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 19 MWINSMQREEPYQGLTYTGTGQRWSFP 99 MW NS QR EPYQGL + FP Sbjct: 1 MWFNSKQRAEPYQGLNVEAVFRDGYFP 27 >EFJ63628.1 hypothetical protein HMPREF9553_00243, partial [Escherichia coli MS 200-1] CCJ46477.1 putative uncharacterized protein, partial [Escherichia coli] ETJ28699.1 ORF16-lacZ fusion protein, partial [Escherichia coli DORA_A_5_14_21] Length = 133 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TG AWLSSARVV+CWVKSRNERNP +LPA Sbjct: 2 TGAAWLSSARVVKCWVKSRNERNPYPLLPA 31 >EFO50065.1 conserved hypothetical protein [Vibrio parahaemolyticus K5030] Length = 87 Score = 55.8 bits (133), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNPCLMLPA 202 TG AWLSSARVV+CWVKSRNERNP LPA Sbjct: 3 TGAAWLSSARVVKCWVKSRNERNPYPCLPA 32 >KQK85721.1 hypothetical protein SETIT_020890mg [Setaria italica] Length = 42 Score = 54.3 bits (129), Expect = 3e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +2 Query: 113 TGGAWLSSARVVRCWVKSRNERNP 184 TGGAWLSSAR VRCWVKSRNERNP Sbjct: 17 TGGAWLSSARAVRCWVKSRNERNP 40 >JAN94712.1 hypothetical protein, partial [Daphnia magna] Length = 71 Score = 54.3 bits (129), Expect = 6e-08 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = -1 Query: 144 TRADDNHAPPVHQPQRERPSLARS-GICQALVRFFALHRINPHAPPLVR 1 TRADD+HA PV + E +++ + CQ VRFFALHRI PH PPLVR Sbjct: 1 TRADDSHAAPVLRFSFEHETISGNFHTCQRWVRFFALHRIKPHHPPLVR 49