BLASTX nr result
ID: Glycyrrhiza28_contig00003457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00003457 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013448824.1 macrophage migration inhibition factor-like prote... 57 2e-08 XP_013448823.1 macrophage migration inhibition factor-like prote... 57 3e-08 XP_019412942.1 PREDICTED: macrophage migration inhibitory factor... 53 2e-06 KJB17123.1 hypothetical protein B456_002G266600 [Gossypium raimo... 50 6e-06 >XP_013448824.1 macrophage migration inhibition factor-like protein [Medicago truncatula] KEH22851.1 macrophage migration inhibition factor-like protein [Medicago truncatula] Length = 114 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 89 YVTVALEGSIPMCFGGTEEPAAYGEFVAI 3 YVTV+LEGSIP+CFG TEEPAAYGEFVAI Sbjct: 38 YVTVSLEGSIPICFGETEEPAAYGEFVAI 66 >XP_013448823.1 macrophage migration inhibition factor-like protein [Medicago truncatula] KEH22850.1 macrophage migration inhibition factor-like protein [Medicago truncatula] Length = 120 Score = 57.4 bits (137), Expect = 3e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 89 YVTVALEGSIPMCFGGTEEPAAYGEFVAI 3 YVTV+LEGSIP+CFG TEEPAAYGEFVAI Sbjct: 38 YVTVSLEGSIPICFGETEEPAAYGEFVAI 66 >XP_019412942.1 PREDICTED: macrophage migration inhibitory factor homolog [Lupinus angustifolius] OIV98568.1 hypothetical protein TanjilG_12154 [Lupinus angustifolius] Length = 120 Score = 52.8 bits (125), Expect = 2e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 89 YVTVALEGSIPMCFGGTEEPAAYGEFVAI 3 YV V LEGSIP+CFGG+EEPAAYGE V+I Sbjct: 38 YVMVGLEGSIPICFGGSEEPAAYGELVSI 66 >KJB17123.1 hypothetical protein B456_002G266600 [Gossypium raimondii] Length = 86 Score = 50.4 bits (119), Expect = 6e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -2 Query: 92 QYVTVALEGSIPMCFGGTEEPAAYGEFVAI 3 QYV + L+GS+PM FGGTE+PAAYGE V+I Sbjct: 2 QYVMIVLKGSVPMSFGGTEQPAAYGELVSI 31