BLASTX nr result
ID: Glycyrrhiza28_contig00003203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00003203 (548 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003593782.1 pyridoxal biosynthesis protein PDX1, putative [Me... 98 3e-21 ABY75167.1 pyridoxine biosynthesis protein, partial [Arachis dio... 90 2e-20 GAU48448.1 hypothetical protein TSUD_383450 [Trifolium subterran... 95 3e-20 XP_014516909.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 93 2e-19 XP_017434080.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 92 3e-19 XP_004485941.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 92 4e-19 XP_003542985.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 92 6e-19 XP_007147987.1 hypothetical protein PHAVU_006G171100g [Phaseolus... 92 6e-19 NP_001238041.1 pyridoxine biosynthesis protein [Glycine max] AAZ... 91 8e-19 KRH11075.1 hypothetical protein GLYMA_15G087200 [Glycine max] 91 8e-19 XP_015942901.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 90 3e-18 XP_006429393.1 hypothetical protein CICLE_v10012274mg [Citrus cl... 89 4e-18 CUQ97482.1 Pyridoxine biosynthesis glutamine amidotransferase, s... 85 8e-18 XP_015897204.1 PREDICTED: probable pyridoxal 5'-phosphate syntha... 89 8e-18 AAZ67141.1 pyridoxine biosynthesis protein [Lotus japonicus] 89 8e-18 KYP40676.1 putative pyridoxal biosynthesis protein PDX1 [Cajanus... 87 1e-17 XP_019430534.1 PREDICTED: probable pyridoxal 5'-phosphate syntha... 88 2e-17 XP_009377760.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 88 2e-17 XP_010037698.1 PREDICTED: pyridoxal 5'-phosphate synthase subuni... 88 2e-17 XP_011080788.1 PREDICTED: probable pyridoxal biosynthesis protei... 87 2e-17 >XP_003593782.1 pyridoxal biosynthesis protein PDX1, putative [Medicago truncatula] AAZ67140.1 pyridoxine biosynthesis protein [Medicago truncatula] AES64033.1 pyridoxal biosynthesis protein PDX1, putative [Medicago truncatula] Length = 314 Score = 97.8 bits (242), Expect = 3e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+LAEVSCGLGEAMVGLNLTDHNVERFANRSE Sbjct: 267 KRARAIVQAVTHYSDPEILAEVSCGLGEAMVGLNLTDHNVERFANRSE 314 >ABY75167.1 pyridoxine biosynthesis protein, partial [Arachis diogoi] Length = 85 Score = 89.7 bits (221), Expect = 2e-20 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL D VERFANRSE Sbjct: 38 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDDKVERFANRSE 85 >GAU48448.1 hypothetical protein TSUD_383450 [Trifolium subterraneum] Length = 311 Score = 95.1 bits (235), Expect = 3e-20 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDP +LAEVSCGLGEAMVGLNLTDHNVERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPGILAEVSCGLGEAMVGLNLTDHNVERFANRSE 311 >XP_014516909.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1 [Vigna radiata var. radiata] Length = 311 Score = 93.2 bits (230), Expect = 2e-19 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL+D+NVERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLSDNNVERFANRSE 311 >XP_017434080.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1 [Vigna angularis] KOM53639.1 hypothetical protein LR48_Vigan09g229800 [Vigna angularis] Length = 311 Score = 92.4 bits (228), Expect = 3e-19 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL+D NVERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLSDSNVERFANRSE 311 >XP_004485941.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1.3 [Cicer arietinum] Length = 309 Score = 92.0 bits (227), Expect = 4e-19 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL D NVERFANRSE Sbjct: 262 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDSNVERFANRSE 309 >XP_003542985.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1 [Glycine max] KRH21198.1 hypothetical protein GLYMA_13G225000 [Glycine max] Length = 311 Score = 91.7 bits (226), Expect = 6e-19 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NLTD VERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLTDDKVERFANRSE 311 >XP_007147987.1 hypothetical protein PHAVU_006G171100g [Phaseolus vulgaris] Q9FT25.1 RecName: Full=Pyridoxal 5'-phosphate synthase subunit PDX1; Short=PLP synthase subunit PDX1; AltName: Full=pvPDX1 AAG17942.1 putative pyridoxine biosynthetic enzyme [Phaseolus vulgaris] AGV54409.1 pyridoxal biosynthesis protein PDX1-like protein [Phaseolus vulgaris] ESW19981.1 hypothetical protein PHAVU_006G171100g [Phaseolus vulgaris] Length = 312 Score = 91.7 bits (226), Expect = 6e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+LAEVSCGLGEAMVG+NL+D NVERFANRSE Sbjct: 265 KRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINLSDTNVERFANRSE 312 >NP_001238041.1 pyridoxine biosynthesis protein [Glycine max] AAZ67142.1 pyridoxine biosynthesis protein [Glycine max] Length = 311 Score = 91.3 bits (225), Expect = 8e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+LAEVSCGLGEAMVG+NLTD VERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINLTDDKVERFANRSE 311 >KRH11075.1 hypothetical protein GLYMA_15G087200 [Glycine max] Length = 311 Score = 91.3 bits (225), Expect = 8e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+LAEVSCGLGEAMVG+NLTD VERFANRSE Sbjct: 264 KRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINLTDDKVERFANRSE 311 >XP_015942901.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1.3 [Arachis duranensis] XP_016181074.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1.3 [Arachis ipaensis] Length = 309 Score = 89.7 bits (221), Expect = 3e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL D VERFANRSE Sbjct: 262 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDDKVERFANRSE 309 >XP_006429393.1 hypothetical protein CICLE_v10012274mg [Citrus clementina] XP_006481040.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Citrus sinensis] XP_015386742.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Citrus sinensis] ESR42633.1 hypothetical protein CICLE_v10012274mg [Citrus clementina] KDO56641.1 hypothetical protein CISIN_1g021578mg [Citrus sinensis] KDO56642.1 hypothetical protein CISIN_1g021578mg [Citrus sinensis] KDO56643.1 hypothetical protein CISIN_1g021578mg [Citrus sinensis] Length = 310 Score = 89.4 bits (220), Expect = 4e-18 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRA+AIV+AVTHYSDPEVLAEVSCGLGEAMVGLNL+DH VERFA+RSE Sbjct: 263 KRAQAIVRAVTHYSDPEVLAEVSCGLGEAMVGLNLSDHKVERFASRSE 310 >CUQ97482.1 Pyridoxine biosynthesis glutamine amidotransferase, synthase subunit [Escherichia coli] Length = 149 Score = 85.1 bits (209), Expect = 8e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 +RARAIVQAVTHYSDP+VLAEVSCGLGEAMVGLNL D VERFA RSE Sbjct: 102 RRARAIVQAVTHYSDPDVLAEVSCGLGEAMVGLNLNDKKVERFAARSE 149 >XP_015897204.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Ziziphus jujuba] XP_015897205.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Ziziphus jujuba] XP_015867957.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Ziziphus jujuba] XP_015867958.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Ziziphus jujuba] Length = 310 Score = 88.6 bits (218), Expect = 8e-18 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+L EVSCGLGEAMVGLNL D VERFANRSE Sbjct: 263 KRARAIVQAVTHYSDPEILTEVSCGLGEAMVGLNLKDEKVERFANRSE 310 >AAZ67141.1 pyridoxine biosynthesis protein [Lotus japonicus] Length = 310 Score = 88.6 bits (218), Expect = 8e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDP +LAE+SCGLGEAMVGLNL D NVERFANRSE Sbjct: 263 KRARAIVQAVTHYSDPGLLAEISCGLGEAMVGLNLNDSNVERFANRSE 310 >KYP40676.1 putative pyridoxal biosynthesis protein PDX1 [Cajanus cajan] Length = 224 Score = 86.7 bits (213), Expect = 1e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLG+AMVG+NL D VERFA+RSE Sbjct: 177 KRARAIVQAVTHYSDPEVLAEVSCGLGDAMVGINLNDSKVERFAHRSE 224 >XP_019430534.1 PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 [Lupinus angustifolius] OIW20189.1 hypothetical protein TanjilG_06590 [Lupinus angustifolius] Length = 309 Score = 87.8 bits (216), Expect = 2e-17 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL D VERFA+RSE Sbjct: 262 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDSKVERFASRSE 309 >XP_009377760.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1.3 [Pyrus x bretschneideri] Length = 309 Score = 87.8 bits (216), Expect = 2e-17 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHY DP+VLAEVSCGLGEAMVGLNL D VERFANRSE Sbjct: 262 KRARAIVQAVTHYQDPDVLAEVSCGLGEAMVGLNLKDEKVERFANRSE 309 >XP_010037698.1 PREDICTED: pyridoxal 5'-phosphate synthase subunit PDX1.3 [Eucalyptus grandis] KCW49454.1 hypothetical protein EUGRSUZ_K02981 [Eucalyptus grandis] Length = 309 Score = 87.8 bits (216), Expect = 2e-17 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 KRARAIVQAVTHYSDPE+LAEVSCGLGEAMVGLNLTD VERFA+RS+ Sbjct: 262 KRARAIVQAVTHYSDPEMLAEVSCGLGEAMVGLNLTDAKVERFASRSD 309 >XP_011080788.1 PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Sesamum indicum] Length = 301 Score = 87.4 bits (215), Expect = 2e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 KRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNLTDHNVERFANRSE 144 +RARAIVQAVTHYSDPEVLAEVSCGLGEAMVG+NL D VER+ANRSE Sbjct: 254 RRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINLNDDKVERYANRSE 301