BLASTX nr result
ID: Glycyrrhiza28_contig00002906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00002906 (409 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003623235.1 leucine-rich receptor-like kinase family protein ... 65 2e-09 GAU35665.1 hypothetical protein TSUD_162360 [Trifolium subterran... 54 5e-07 >XP_003623235.1 leucine-rich receptor-like kinase family protein [Medicago truncatula] AES79453.1 leucine-rich receptor-like kinase family protein [Medicago truncatula] Length = 1003 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/44 (68%), Positives = 40/44 (90%), Gaps = 2/44 (4%) Frame = -3 Query: 365 DQRAIRREQEV--FDTMENCLVSVLQIGVSCSATSPSERMPMTV 240 +++A+RRE+E F TMENCL+SVLQIGVSCS+TSP+ER+PMT+ Sbjct: 947 EEKALRREKEPGDFSTMENCLISVLQIGVSCSSTSPNERIPMTL 990 >GAU35665.1 hypothetical protein TSUD_162360 [Trifolium subterraneum] Length = 100 Score = 54.3 bits (129), Expect = 5e-07 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -3 Query: 365 DQRAIRREQEVFD--TMENCLVSVLQIGVSCSATSPSERMPMTV 240 ++ A+R+E D TMENCLVSVLQIGV+CS+TSP ER+PM + Sbjct: 43 EEIALRKENAPGDLSTMENCLVSVLQIGVTCSSTSPRERIPMNM 86