BLASTX nr result
ID: Glycyrrhiza28_contig00002341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00002341 (621 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI39675.3 unnamed protein product, partial [Vitis vinifera] 77 8e-15 AFK48113.1 unknown [Medicago truncatula] 74 2e-14 XP_018722406.1 PREDICTED: uncharacterized protein LOC104429784 [... 79 5e-14 XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [... 77 1e-13 XP_003626135.2 low temperature and salt responsive family protei... 57 1e-07 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 56 1e-07 XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bre... 54 1e-06 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 54 1e-06 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 54 1e-06 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 54 1e-06 KMZ61773.1 Low temperature and salt responsive protein [Zostera ... 53 3e-06 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 53 3e-06 XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radia... 53 3e-06 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 53 3e-06 XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglan... 52 4e-06 XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus ... 52 4e-06 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 52 4e-06 XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium r... 52 6e-06 XP_011087564.1 PREDICTED: hydrophobic protein RCI2B [Sesamum ind... 52 6e-06 XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossyp... 52 6e-06 >CBI39675.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 77.0 bits (188), Expect = 8e-15 Identities = 38/64 (59%), Positives = 43/64 (67%) Frame = +1 Query: 103 KRERENGKGRHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSRNHLCYLCH 282 K ENG S+L+RH HH + WCLPQVW+P GVLDLFGA F + S N LC LCH Sbjct: 38 KTREENG----SHLHRHSLGHHLAPPWCLPQVWMPGGVLDLFGADFFRLPSWNCLCCLCH 93 Query: 283 HQVI 294 HQVI Sbjct: 94 HQVI 97 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 74.3 bits (181), Expect = 2e-14 Identities = 32/57 (56%), Positives = 42/57 (73%) Frame = +1 Query: 142 LYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSRNHLCYLCHHQVI*LPLIN 312 ++R+ HHP S+ CLPQVWLP GVL LFG +PFW+ N LCYLC++QVI L ++ Sbjct: 1 MHRYHCCHHPPSSRCLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVINLAFVD 57 >XP_018722406.1 PREDICTED: uncharacterized protein LOC104429784 [Eucalyptus grandis] Length = 339 Score = 79.3 bits (194), Expect = 5e-14 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = +1 Query: 103 KRERENGKGRHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSRNHLCYLCH 282 +R R+NG H L+RHPP HH +S+ LPQVWLP GVLDL AH + SR HLC+LCH Sbjct: 234 ERNRKNGGRGHDELHRHPPSHHLASSRGLPQVWLPGGVLDLCVAHYLRLDSRYHLCHLCH 293 Query: 283 HQV 291 +QV Sbjct: 294 YQV 296 >XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 76.6 bits (187), Expect = 1e-13 Identities = 37/72 (51%), Positives = 48/72 (66%) Frame = +1 Query: 130 RHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSRNHLCYLCHHQVI*LPLI 309 R+ L RHPPRH +S+W LPQVWLP G+LDLF A W++ ++LC+LCHHQV + Sbjct: 122 RNIKLRRHPPRHPLASSWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQV----MS 177 Query: 310 NFASVDNE*LYV 345 NF D + YV Sbjct: 178 NFCIRDAKDTYV 189 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 56.6 bits (135), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLKFGCHVEFW+CLVLTLF Sbjct: 2 GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF 39 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 56.2 bits (134), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLK+GCHVEFWICLVLTLF Sbjct: 4 GTATCIDILLAIILPPLGVFLKYGCHVEFWICLVLTLF 41 >XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] XP_009366022.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTA C GVFLKFGCHVEFWICLVLT F Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFF 42 >KMZ61773.1 Low temperature and salt responsive protein [Zostera marina] Length = 54 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 2 GTTNCIDILVAIFLPPIGVFLKFGCHVEFWICLLLTLF 39 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTA C GVFLKFGC+VEFWICLVLTLF Sbjct: 5 GTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLTLF 42 >XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] XP_017413861.1 PREDICTED: hydrophobic protein RCI2B [Vigna angularis] KOM35416.1 hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLK+GC VEFWICLVLTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF 42 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLKFGC VEFWICL+LTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLF 42 >XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLKFGC VEFWICL+LT+F Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLTIF 42 >XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 5 GTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLTLF 42 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GT TC GVFLKFGC VEFWICLVLTLF Sbjct: 5 GTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLTLF 42 >XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] XP_016667936.1 PREDICTED: hydrophobic protein RCI2B [Gossypium hirsutum] KJB82717.1 hypothetical protein B456_013G210800 [Gossypium raimondii] KJB82718.1 hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +2 Query: 134 TATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 TATC GVFLKFGC VEFWICLVLTLF Sbjct: 6 TATCVDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42 >XP_011087564.1 PREDICTED: hydrophobic protein RCI2B [Sesamum indicum] Length = 57 Score = 52.0 bits (123), Expect = 6e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +2 Query: 131 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 GTATC GVFLKFGC VEFWICL+LT+F Sbjct: 4 GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIF 41 >XP_016673999.1 PREDICTED: hydrophobic protein RCI2B-like [Gossypium hirsutum] XP_017618304.1 PREDICTED: hydrophobic protein RCI2B [Gossypium arboreum] KHG20782.1 Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +2 Query: 134 TATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 244 TATC GVFLKFGC VEFWICLVLTLF Sbjct: 6 TATCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42