BLASTX nr result
ID: Glycyrrhiza24_contig00032751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00032751 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592217.1| hypothetical protein MTR_1g100200 [Medicago ... 123 1e-26 ref|XP_003551155.1| PREDICTED: UPF0496 protein At3g49070-like [G... 101 7e-20 ref|XP_002513670.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|XP_004158156.1| PREDICTED: UPF0496 protein At3g49070-like [C... 73 3e-11 ref|XP_002272472.1| PREDICTED: UPF0496 protein At3g49070-like [V... 73 3e-11 >ref|XP_003592217.1| hypothetical protein MTR_1g100200 [Medicago truncatula] gi|355481265|gb|AES62468.1| hypothetical protein MTR_1g100200 [Medicago truncatula] Length = 366 Score = 123 bits (309), Expect = 1e-26 Identities = 63/81 (77%), Positives = 70/81 (86%), Gaps = 1/81 (1%) Frame = +1 Query: 1 NKLIRRIKKLLSRSVCRTKPSSPNHQTHVDVREEYANAFRTESYIEFWTRVLAYSNKGEY 180 NKL+RRIKK+L SVCR+ SSPNHQTHVDVREEYANAFRTESY+EFWTRV++YSN + Sbjct: 9 NKLVRRIKKMLPCSVCRS--SSPNHQTHVDVREEYANAFRTESYVEFWTRVVSYSNGPQR 66 Query: 181 TSCLSR-EFTTSARLPSYRLF 240 SCLSR E TTS RLPSYRLF Sbjct: 67 RSCLSREESTTSTRLPSYRLF 87 >ref|XP_003551155.1| PREDICTED: UPF0496 protein At3g49070-like [Glycine max] Length = 349 Score = 101 bits (251), Expect = 7e-20 Identities = 52/69 (75%), Positives = 55/69 (79%) Frame = +1 Query: 34 SRSVCRTKPSSPNHQTHVDVREEYANAFRTESYIEFWTRVLAYSNKGEYTSCLSREFTTS 213 S + SSPNHQT VDVREEYAN FRTESY EFWTRVLAYS K E ++CLSRE TTS Sbjct: 3 SFDILECSTSSPNHQTCVDVREEYANTFRTESYTEFWTRVLAYS-KDESSTCLSRESTTS 61 Query: 214 ARLPSYRLF 240 ARLPSYRLF Sbjct: 62 ARLPSYRLF 70 >ref|XP_002513670.1| conserved hypothetical protein [Ricinus communis] gi|223547578|gb|EEF49073.1| conserved hypothetical protein [Ricinus communis] Length = 370 Score = 73.9 bits (180), Expect = 1e-11 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +1 Query: 64 SPNHQTHVDVREEYANAFRTESYIEFWTRVLAYSNKGEYTSCLSREFTTSARLPSYRLF 240 +PN VDVREEYANAFRTESY EFWT VLA S+ G+ + + E TT+ARLPSYRLF Sbjct: 14 TPNLSIGVDVREEYANAFRTESYNEFWTHVLALSD-GDSVTGIPVESTTAARLPSYRLF 71 >ref|XP_004158156.1| PREDICTED: UPF0496 protein At3g49070-like [Cucumis sativus] Length = 371 Score = 72.8 bits (177), Expect = 3e-11 Identities = 42/79 (53%), Positives = 51/79 (64%) Frame = +1 Query: 4 KLIRRIKKLLSRSVCRTKPSSPNHQTHVDVREEYANAFRTESYIEFWTRVLAYSNKGEYT 183 K+I +KK LS S N+ DV EEYANAFRTESYI+FWTRV+A +N T Sbjct: 5 KIISCLKKFLSCS--DGGQHVINYPVDTDVGEEYANAFRTESYIDFWTRVVALNNGDNLT 62 Query: 184 SCLSREFTTSARLPSYRLF 240 + +S E TT+ RL SYRLF Sbjct: 63 AQVSLESTTATRLSSYRLF 81 >ref|XP_002272472.1| PREDICTED: UPF0496 protein At3g49070-like [Vitis vinifera] Length = 380 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/58 (63%), Positives = 44/58 (75%) Frame = +1 Query: 67 PNHQTHVDVREEYANAFRTESYIEFWTRVLAYSNKGEYTSCLSREFTTSARLPSYRLF 240 PN +VD REEYANAFRTESYIEFWTRVL ++ G+ + + E TT+ARL SYRLF Sbjct: 52 PNLPNYVDYREEYANAFRTESYIEFWTRVLTLTH-GDSATSIPIESTTAARLSSYRLF 108 Database: ./nr Posted date: Mar 14, 2013 10:53 AM Number of letters in database: 8,123,359,852 Number of sequences in database: 23,641,837 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 23641837 Number of Hits to DB: 397,996,954,024,870 Number of extensions: 2136708743 Number of successful extensions: 1115489616 Number of sequences better than 1.0e-05: 83927465 Number of HSP's gapped: 805987759 Number of HSP's successfully gapped: 109896736 Length of database: 8,123,359,852 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 28 (15.4 bits)